(data stored in ACNUC7421 zone)

EMBL: CP002343.PE495

CP002343.PE495       Location/Qualifiers
FT   CDS_pept        complement(551623..552087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_5325 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S981"
FT                   /protein_id="ADU47057.1"
FT                   /translation="MDEAVERFGSAKEGYAPPPRPDGVDDATVEALGKLSEALEVVEHA
FT                   RGLLYGFHRLVGRADATLQEAVTLLRDARYDACADVVEECVVGRNVLPGLWTFQMIEAF
FT                   DDGYWRVFREVVDEVRAATGDPERHRYEAEMKAREQRPKGAAGAPPDGAV"
     gtggacgagg cagtggaacg gttcggcagc gccaaggagg gctacgcgcc gccaccccgc        60
     cccgacggcg tggacgacgc gaccgtcgag gcgctcggca agctgtcgga ggcgctcgag       120
     gtggtcgagc acgcgcgcgg cctgctctac gggttccacc ggctggtcgg gcgcgccgac       180
     gcgaccctgc aggaggcggt cacgctgctc cgcgacgccc ggtacgacgc ctgcgccgac       240
     gtcgtcgagg agtgtgtcgt cggacggaac gtgctgcccg gcctgtggac gttccagatg       300
     atcgaggcgt tcgacgacgg ctactggagg gtgttccgcg aggtggtcga cgaggtgcgg       360
     gcggcgacgg gcgacccgga gcggcaccgc tacgaggccg agatgaaggc ccgggagcag       420
     cggccgaagg gtgcagcggg agcaccaccc gacggcgccg tgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page