(data stored in ACNUC7421 zone)

EMBL: CP002343.PE498

CP002343.PE498       Location/Qualifiers
FT   CDS_pept        554217..555533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0515"
FT                   /product="HNH nuclease"
FT                   /note="InterPro IPR003615; KEGG: kse:Ksed_09510 HNH
FT                   endonuclease; SMART: HNH nuclease; SPTR: HNH endonuclease;
FT                   PFAM: HNH endonuclease; Domain of unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47060"
FT                   /db_xref="GOA:E6S984"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:E6S984"
FT                   /protein_id="ADU47060.1"
FT                   /translation="MKAEQLIEAEGLVAALELAVDVVQRLTSDFPTWSLPEAEVSAGVA
FT                   GAQRLAQLSQTLTAVLAKEAHSRGLGADNGLSRIDWLKAQAPTLEGSSAPALALLGAAM
FT                   NEPRWDALSEKVTSGQVSVAAATVVLRLHQDVSRIADPEQLDEIIAVIVDKIEHLTVKE
FT                   LNRVAAQARAALKPPSELDREDAGRRLGRSLSKIGSTADYTEYRLRLDPEGSAILDAAI
FT                   DPLARPRPDVEWTGDTKDDPRTPAARRADALLELVGRAVAAPQGVTRTSRTKLVVTMSY
FT                   EALLDQLRGAGVADNDAVLSPGTVRRLACEAEIVPMVLGSPSQVLDQGFSERYFTTAQR
FT                   LALARRDQGCSFPGCSIPPQWCDAHHIEHWSRGGPTDLGNGALLCGRHHTIVHERDLTA
FT                   QIGPHGVTWLLGGLPISIGPRAPRTTWRPHATEDLPLGA"
     gtgaaggcgg agcagctgat tgaggcagag ggcctcgtcg ctgccctcga gctcgccgtc        60
     gatgtggtcc agcggctcac ctcggacttt ccgacgtggt cacttcccga ggcagaggtg       120
     agcgccggtg tcgccggggc ccagcggttg gcccagctga gtcagaccct gaccgcggtg       180
     ctggccaagg aggcccactc ccgcgggctg ggcgccgaca acggactgtc ccggatcgac       240
     tggctcaagg cgcaggcacc gacgctcgag ggcagctcgg ctccggcact ggccctcctc       300
     ggagccgcga tgaacgagcc gcgctgggac gcactgtccg agaaggtcac gtccggccag       360
     gtgtccgtgg ccgcggcgac cgtggtcctg cggctgcacc aggatgtctc ccggatcgcc       420
     gacccggagc agctcgacga gatcatcgcg gtcatcgtcg acaagatcga gcacctgacc       480
     gtcaaggagc tgaaccgcgt tgcggcccag gcccgcgcag cgctgaagcc gccgagcgag       540
     ctcgaccgtg aggatgccgg tcgccggctc gggcggtccc tcagcaagat cgggtccacg       600
     gctgactaca cggagtaccg gctccgcctc gaccccgagg gctcggcgat cctcgacgcg       660
     gccatcgacc ccttggcgcg accgcggccc gacgtcgaat ggaccggcga caccaaggat       720
     gacccgcgca ctcccgcggc ccggcgcgcc gacgcgctcc tcgagctggt cggtcgggcc       780
     gtcgcggccc cgcagggcgt gacgcgcacg tcgcgcacca agctcgtcgt cacgatgagc       840
     tacgaggcgc tgctcgacca gctccggggt gcgggcgtgg ctgacaacga cgccgttctc       900
     tcgccgggaa cggtccgtcg gctggcctgc gaggccgaga tcgtgcccat ggtgctcggc       960
     agcccttctc aggtgcttga ccagggcttc agtgagcgat atttcacgac ggcccagcgg      1020
     ctcgcgctcg ccagacgaga ccaggggtgt tcgttcccgg ggtgctcgat cccaccgcag      1080
     tggtgcgacg cgcaccatat cgagcactgg tcccgcggcg gtccgaccga cctcggcaac      1140
     ggtgcgctgc tctgcgggcg gcaccacacg atcgtgcacg agcgcgacct cacggcccag      1200
     atcggtccgc acggtgtgac gtggttgctg ggcgggctgc cgatctccat cggaccgcgc      1260
     gcgccccgga cgacgtggcg cccccacgcc accgaggact tgccgctcgg ggcctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page