(data stored in ACNUC7421 zone)

EMBL: CP002343.PE499

CP002343.PE499       Location/Qualifiers
FT   CDS_pept        complement(555813..557789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0516"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873: IPR020845: IPR011904;
FT                   KEGG: bcv:Bcav_0611 acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: Acetate/CoA ligase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: Domain of unknown function
FT                   (DUF3448); AMP-binding enzyme; TIGRFAM: acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47061"
FT                   /db_xref="GOA:E6S985"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S985"
FT                   /protein_id="ADU47061.1"
FT                   /translation="MSETLENLLQETRTFPPPPEFASRANGTAELYEKADADHEGFWAE
FT                   QARTYVSWSKDFTQTLQWDTPFAKWFPDGELNACYNAVDRHVEAGNGDRVAIHWIGEPE
FT                   GDTREITYSDLHSSVQRAANALQDIGVRKGDTVAIYLPMIPEAAVAMLACARIGAPHSV
FT                   VFGGFSAEALHSRIDDAGAKVVITSDGGYRRGSASPLKPAVDAALDHGDTSVEKVLVVK
FT                   RTGQETPWTEGRDLWWDEVLEQAAPTHEAPAHESEHPLFILYTSGTTGKPKGIFHTTGG
FT                   YLTQCAYTNAVVHDVHPESDVYWCTADIGWVTGHSYIVYGPLTLGATQVMYEGTPDTPH
FT                   QGRFWEIVEQKKVTILYTAPTAIRTFMKWGDDIPGKFDLSSLRLLGSVGEPINPEAWMW
FT                   YRRVIGGDRCPIVDTWWQTETGAIMVSPLPGVTATKPGSAQRAIPGIGAEVVDDMAQPV
FT                   PNGHGGYLVLTKPWPAMLRGIWGDPERYKETYWSRFEGLYFAGDGAKKDDDGDIWLLGR
FT                   VDDVMNVSGHRLSTTEIESALVSHPKVAEAAVVGATDETTGQAVVAFVILRSEAVAEAD
FT                   EPGEGADIVAELRNHVAKEIGPIAKPRSIMIVPELPKTRSGKIMRRLLRDVAENRQVGD
FT                   VTTLADSSVMELIKTGLNKGDGD"
     atgagcgaaa cgctcgagaa cctcctccag gagactcgga ccttcccacc ccctcctgag        60
     ttcgcttccc gggccaacgg cacggctgag ctgtacgaga aggcggacgc cgaccacgag       120
     ggcttctggg ccgagcaggc ccgcacgtac gtgtcgtgga gcaaggactt cacgcagacc       180
     ctccagtggg acaccccgtt cgccaagtgg ttccccgacg gcgagctcaa cgcctgctac       240
     aacgcggtcg accggcacgt cgaggccggc aacggcgacc gggtcgcgat ccactggatc       300
     ggcgagcccg agggtgacac ccgcgagatc acctactccg acctgcactc ctcggtccag       360
     cgggccgcga acgcgctgca ggacatcggg gtccgcaagg gtgacacggt cgcgatctac       420
     ctgccgatga tcccggaggc ggccgtcgcg atgctcgcct gcgcccgcat cggcgcgccc       480
     cactccgtcg tcttcggtgg gttctcggcc gaggccctgc actcgcgcat cgacgacgcc       540
     ggcgccaagg tcgtcatcac gtccgacggt ggctaccgcc gcggtagcgc ctccccgctc       600
     aagccggccg tcgacgccgc cctcgaccac ggtgacacgt cggtcgagaa ggtgctcgtc       660
     gtcaagcgca ccggccagga gaccccgtgg accgagggcc gcgacctctg gtgggacgag       720
     gtgctcgagc aggccgcccc gacccacgag gcgccggcgc acgagtccga gcacccgctg       780
     ttcatcctct acacgtcggg gaccaccggg aagcccaagg gcatcttcca cacgaccggc       840
     gggtacctca cgcagtgcgc gtacacgaac gccgtggtcc acgacgtcca cccggagagc       900
     gacgtctact ggtgcaccgc cgacatcggc tgggtgaccg gccactccta catcgtctac       960
     gggccgctga cgctcggcgc gactcaggtg atgtacgagg gcaccccgga caccccgcac      1020
     cagggtcgct tctgggagat cgtcgagcag aagaaggtga cgatcctcta caccgctccg      1080
     acggcgatcc gcaccttcat gaagtggggc gacgacatcc cgggcaagtt cgacctgagc      1140
     tcgctgcggc tgctcggctc ggtcggtgag ccgatcaacc ccgaggcctg gatgtggtac      1200
     cgccgcgtca tcggtgggga ccgctgcccg atcgtcgaca cgtggtggca gacggagacc      1260
     ggggcgatca tggtcagtcc cctccccggt gtcacggcga ccaagccggg gtcggcccag      1320
     cgggcgatcc cgggtatcgg cgccgaggtc gtcgacgaca tggcacagcc ggtccccaac      1380
     ggccatggcg gctacctcgt gctgaccaag ccgtggccgg cgatgctgcg cggcatctgg      1440
     ggcgacccgg agcgctacaa ggagacgtac tggagccggt tcgagggcct ctacttcgcc      1500
     ggcgacggcg cgaagaagga cgatgacggc gacatctggc tgctcggccg cgtcgacgac      1560
     gtcatgaacg tctcgggtca ccgcctgtcg acgacggaga tcgagtccgc cctcgtgtcg      1620
     cacccgaagg tcgccgaggc cgctgtcgtc ggcgcgacgg acgagacgac gggccaggcg      1680
     gtcgtggcgt tcgtcatcct ccggtccgaa gcggtcgccg aggccgacga gccgggtgag      1740
     ggcgccgaca tcgtcgccga gctgcgcaac cacgtcgcga aggagatcgg ccccatcgcg      1800
     aagccgcggt cgatcatgat cgttcccgag ctgccgaaga cgcgctccgg caagatcatg      1860
     cgccgcctgc tccgcgacgt cgccgagaac cgccaggtcg gcgacgtgac gacgctcgcg      1920
     gacagctcgg tcatggagct gatcaagacc ggactcaaca agggcgacgg ggactga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page