(data stored in SCRATCH zone)

EMBL: CP002343.PE50

CP002343.PE50        Location/Qualifiers
FT   CDS_pept        complement(55686..57110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0050"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR006094: IPR004113: IPR016166; KEGG:
FT                   sen:SACE_4261 (S)-2-hydroxy-acid oxidase, subunit D; PFAM:
FT                   FAD linked oxidase domain protein; SPTR: (S)-2-hydroxy-acid
FT                   oxidase, subunit D; PFAM: FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycolate oxidase,
FT                   subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46612"
FT                   /db_xref="GOA:E6SEL1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL1"
FT                   /protein_id="ADU46612.1"
FT                   /translation="MSTQGTTPRLHPSGSGLPADVLVELRGIVGDQYVLSLDGDVEPFS
FT                   RDATPLFRARPDAVVLPGTTEEVSAVLTLASRRGIPVTPRGAGSNLAAATIPEHGGIVL
FT                   VLTRMNRVLEVSEGELLAVVQAGTTTVTLAEAAAAKGLLYAPDPGSRTVSTVAGNVAMC
FT                   AGGLRGLKYGVTRNYVLGLEVVLPTGEVMRTGGRLWKDVAGYDLTRLLTGSEGTLAVIT
FT                   EITVGLLPMPATAMTGLAYFDHLSDAGRAVARIIAEGTLPATLEFLDNRCVNAVEDYAQ
FT                   LGLDREAGALLLFGDDGGEEMVASSLQRMADVCTAVGARGVTLAQDIAGSEALLTARRC
FT                   SLPALARLAPITMLEDVTVPRPRLAEMVETIDAIATKHSVTCATFGHAGDGNLHPTIVF
FT                   DPDDGDARHRAEAAFDEIFHAAMALGGTITGEHGVGAAKRPWLAARLGPVQMALLQRIK
FT                   TAFDPAGILNPGKLGS"
     atgagcactc agggcaccac cccccggctc cacccctccg gcagcggact cccggccgac        60
     gtcctggtcg agctccgtgg catcgtcggt gaccagtacg tcctcagcct cgacggcgac       120
     gtcgagccct tctcccgcga cgcgacgccg ctcttccggg cccgcccgga cgccgtggtc       180
     ctgccgggca ccaccgagga ggtgagcgcc gtcctgacgc tcgcgtcgcg gcgcggcatc       240
     ccggtcaccc cccgcggggc cggctccaac ctcgccgccg cgacgatccc cgagcacggc       300
     ggcatcgtcc tcgtcctcac ccggatgaac cgggtgctcg aggtgagcga gggcgagctg       360
     ctcgccgtcg tccaggccgg gacgacgacc gtgacgctcg ccgaggcggc ggccgccaag       420
     gggctgctct atgcacccga cccgggcagt cggaccgtgt ccaccgtggc cggcaacgtc       480
     gccatgtgcg cgggcggcct gcgtggcctg aagtacggcg tgacccgcaa ctacgtcctc       540
     ggcctggagg tcgtcctccc gaccggcgag gtgatgcgga ccggtgggcg gctctggaag       600
     gacgtcgccg gctacgacct cacccggctg ctcaccggct ccgagggcac cctcgccgtg       660
     atcaccgaga tcaccgtggg cctgctgccg atgccggcga cggcgatgac cggcctggcc       720
     tacttcgacc acctgtccga cgccggccgg gcggtggccc ggatcatcgc ggagggcacc       780
     ctgccggcga cgctcgagtt cctcgacaac cggtgcgtca acgcggtcga ggactacgcg       840
     cagctcggcc tcgaccgcga ggcgggtgcc ctgctgctct tcggtgacga cggcggagag       900
     gagatggtcg cctcgtcgtt gcagcggatg gccgacgtgt gcaccgcggt cggcgcccgt       960
     ggcgtcaccc tcgcccagga catcgccggg tcggaggcgc tcctcacggc gcgccgctgc      1020
     tcgttgccgg ccctggcccg gctcgcgccg atcaccatgc tcgaggacgt caccgtcccc      1080
     cgcccccgcc tcgccgagat ggtggagacg atcgacgcca tcgccacgaa gcactccgtc      1140
     acgtgcgcga cgttcggcca tgcgggggac gggaacctcc accccacgat cgtgttcgac      1200
     cccgacgacg gcgatgcccg ccaccgtgcg gaggcggcct tcgacgagat cttccacgcc      1260
     gcgatggccc tgggtggcac gatcaccggt gagcacgggg tcggcgcggc caagcgcccc      1320
     tggctcgcgg cccgcttggg cccggtgcag atggcgctgc tgcagcggat caagacggcc      1380
     ttcgaccctg ccgggatcct caacccgggc aagctgggct catga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page