(data stored in ACNUC7421 zone)

EMBL: CP002343.PE500

CP002343.PE500       Location/Qualifiers
FT   CDS_pept        558482..559366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_25360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47062"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E6S986"
FT                   /protein_id="ADU47062.1"
FT                   /translation="MSDPKPARNPIVDQLAALADLPGVRGRADAVRGACTRLRFHEALR
FT                   RRIPEAAAESRVRGARASAALDGVDYPVDLVRELTTGARPWPDELTPDLATLKGAIAAT
FT                   AESERVATIVRTAPLQALARLHVAAASPLVGGERPELLGRPRIAGEECTEFVDLGPAPD
FT                   AAEVSRRLSQLADLIVAASAATNRVPAVVVSSVVHGEVIAIRPFVHGNGLVARALERAL
FT                   VQALGLDPTGVAVPEAGHVANGTVTYTGSSAAYGKGTAAGVGLWLGQAADALLKGVDEG
FT                   ERICDAVRAGRLS"
     gtgtccgacc cgaagcctgc ccgcaacccg atcgtcgacc agctcgccgc ccttgccgac        60
     ctccccggcg tgcgcgggag ggccgacgcc gtgcgggggg cctgcaccag gctgcgcttc       120
     cacgaggcgc tgagacgtcg cattcctgag gccgcggccg agtcgcgagt ccgcggggcc       180
     cgcgcgtcgg cagccctcga cggcgtcgac tacccggtcg acctcgtccg tgagctgacg       240
     acgggcgcgc gcccctggcc ggacgagctc accccggacc tggccaccct caagggggcc       300
     atcgccgcca ccgccgagag cgagcgcgtc gccaccatcg tccggaccgc tccgctccag       360
     gcgctcgcgc ggctgcacgt cgcagcagcg tctcctctcg tcggcggtga gcggccggag       420
     ttgctcgggc ggccccggat cgcgggggag gagtgcaccg agttcgtcga cctcggcccg       480
     gccccggacg ctgcggaggt gtcgcgacgc ctgagccagc tcgcggacct catcgtcgcc       540
     gcctcggccg ccacgaaccg cgttcccgca gtggtggtct cgtcagtcgt gcacggtgag       600
     gtcatcgcca tccgcccgtt cgtgcacggg aacggtctcg tcgcccgggc cctggagcgg       660
     gccctcgtcc aggccctcgg cctcgacccg accggtgtcg cggtccccga agccggccac       720
     gtcgcgaacg ggacggtgac ctacacaggg agctcagcgg catacgggaa agggactgcc       780
     gccggggtgg gactgtggct cgggcaggcg gccgacgcgc tgctcaaggg cgtcgacgag       840
     ggcgaacgga tctgtgacgc ggtgcgcgca ggacgcctca gctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page