(data stored in ACNUC7421 zone)

EMBL: CP002343.PE502

CP002343.PE502       Location/Qualifiers
FT   CDS_pept        560972..562153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0519"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482: IPR017975; KEGG: kse:Ksed_25300
FT                   Flp pilus assembly protein, ATPase CpaF; PFAM: type II
FT                   secretion system protein E; SPTR: Flp pilus assembly
FT                   protein, ATPase CpaF; PFAM: Type II/IV secretion system
FT                   protein; TIGRFAM: helicase/secretion neighborhood ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47064"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S988"
FT                   /protein_id="ADU47064.1"
FT                   /translation="MVRVTLTPAMWQRVREGRGPDPSLVTDVAKEETGALGAQRVAASR
FT                   EAIAARVLGAGPLEEWLDDGDVTDLALNGDGKVWVDRGAGMEWTGHVVPADDARGLAVR
FT                   LAAGAGRRLDEASPWVDGQLPSGARLHAVLPPLVAGGPHITIRVPARDHLSFGRLEAGG
FT                   MFPAPWGQVLRQVVARRLAFVVSGGTGAGKTTILAALLGLVDPSDRLLVVEDVRELHVD
FT                   HPHVVRLEARPPNVEGMGEVTLTTLVRQSLRMRPDRIVVGEVRGAEVRELLAALNTGHE
FT                   GGCGTVHANAPEDVIARFEALGALAGLGPAAVRAQLAAAVDVVVHVARLGPVRRVETIS
FT                   ALFRRGGEPVVETALSRGGTDGASRVGPAWPALAHRLGIDPGCVAGTTPGAGA"
     gtggtccgcg tgacgctcac cccggccatg tggcagcggg tccgggaagg ccgcggtcca        60
     gacccatctc tggtgacgga cgtggccaag gaggagaccg gggcgctcgg tgcccagcgt       120
     gtcgctgcct cgcgggaggc gatcgcggcg cgcgtcctcg gagcagggcc actcgaggaa       180
     tggctcgacg atggcgacgt caccgacctc gccctcaacg gggacggcaa ggtctgggtg       240
     gaccggggag ccgggatgga gtggaccggg cacgtcgtgc cggcggacga cgcgcgaggc       300
     ctggccgtgc gcctcgccgc tggcgccggt cgccgtctcg acgaagccag cccctgggtc       360
     gatggccagc tgccgtcggg cgcccgcctg cacgcggtgc tgccgccgct cgtcgccggg       420
     ggaccgcaca tcacgatccg cgtcccggcc cgcgaccacc tctcgttcgg gaggttggag       480
     gccgggggca tgttcccggc gccgtggggc caggtgctgc ggcaggtcgt ggcgcggcgg       540
     ctggccttcg tggtctcggg tggaacgggc gccggcaaga cgacgatcct cgcggcgctc       600
     ctcggcctcg tcgacccgag cgaccggctg ctcgtcgtgg aggacgtgcg ggagctgcac       660
     gtcgaccacc cgcacgtggt ccggctcgag gcgcgaccgc cgaacgtcga agggatgggc       720
     gaggtgacac tgacgacgct cgtccggcag tccctccgga tgcgtcccga ccgcatcgtc       780
     gtcggcgagg tgaggggtgc cgaggtccgc gagctgcttg ccgcgctcaa caccggtcac       840
     gagggaggct gcggcaccgt ccacgcgaac gcgcctgagg acgtcatcgc ccggttcgag       900
     gcactggggg cgctcgccgg actcggtccg gctgcggtgc gggcccagct ggcagcggcg       960
     gtcgacgtcg tggtccacgt tgctcgactc ggtccggtgc ggcgggtgga gacgatctcg      1020
     gcgctgttcc gccggggcgg ggagcccgtc gtggagaccg cactgtcccg gggagggact      1080
     gacggtgcca gccgggtcgg acctgcctgg ccggctctcg cgcaccgcct cggcatcgat      1140
     ccgggttgtg tggccggcac gacgccgggg gcgggagcgt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page