(data stored in ACNUC7421 zone)

EMBL: CP002343.PE503

CP002343.PE503       Location/Qualifiers
FT   CDS_pept        562156..562956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0520"
FT                   /product="Type II secretion system F domain"
FT                   /note="InterPro IPR018076; KEGG: kse:Ksed_25290 Flp pilus
FT                   assembly protein TadB; PFAM: Type II secretion system F
FT                   domain; SPTR: Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47065"
FT                   /db_xref="GOA:E6S989"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S989"
FT                   /protein_id="ADU47065.1"
FT                   /translation="MAVVAGVVLAASVLLWPVGGRVAEVRRVLGGGALEGRNAPEPGPR
FT                   WAQLRGVWGSDPVELFHDWRRRRRSGSSVSSAVALLEGVAPALEAGLTPSVAVRLSGAT
FT                   LRSSIDPLTARLVAELTETSERGAHVAPVWRSWAGAEGSEELRFVAAAWQLSEVTGAPL
FT                   ADAVRRAVASVHQARERARRVHVAVAGPRATVVVLTVLPLTGPLFGLACGVPPTELYLA
FT                   SPLSSAAAALGLVLIWVGRRWCRRLVESAVSVGGADGAGSWSRR"
     gtggcggtgg tggccggggt cgtcctggcc gcctcggtgc tcttgtggcc ggtcggtggg        60
     cgggtggcgg aggtccgtcg cgttctgggc gggggagccc tcgagggaag gaacgcaccc       120
     gagccggggc cgcgctgggc gcagctgcgc ggggtgtggg gatcggaccc cgtcgagctc       180
     tttcacgatt ggcgccggcg ccgccggtcg gggtcgtcgg tgtccagcgc agtggcgctc       240
     ctcgaaggcg tggccccggc tctcgaggcg ggcttgacac cgtcggtggc ggttcggctg       300
     tccggtgcga cgctcaggtc ctccatcgac ccgctgactg cgcgtctcgt tgcggagctg       360
     accgagacca gcgaacgggg tgctcacgtg gcgccggtgt ggcgctcctg ggctggggcc       420
     gagggctccg aagagcttcg cttcgtcgcg gcggcgtggc agctgtccga ggtgaccggc       480
     gcgcccctcg ccgacgcggt tcgccgggcg gtggcctcag tgcaccaggc gcgggagcga       540
     gcccgtcggg tgcacgtcgc cgttgccggg cctcgagcca ccgtcgtggt gctcaccgtg       600
     ctgcccctga ccgggccgct cttcggcctg gcctgtgggg tgccgccgac cgagctgtac       660
     ctcgcttccc cgctgagcag cgcggcggcc gccctcggcc tggtgctgat ctgggtgggg       720
     cgtcgatggt gccgacgcct ggtcgagtcg gcggtctccg tcggtggcgc cgacggtgcg       780
     ggctcgtgga gccgaaggtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page