(data stored in ACNUC7421 zone)

EMBL: CP002343.PE511

CP002343.PE511       Location/Qualifiers
FT   CDS_pept        complement(567250..568137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0528"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="COGs: COG0555 ABC-type sulfate transport system
FT                   permease component; InterPro IPR000515: IPR005667:
FT                   IPR011865; KEGG: rha:RHA1_ro01272 ABC sulfate/thiosulfate
FT                   porter, permease component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Sulfate/thiosulfate ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; TIGRFAM: sulfate ABC
FT                   transporter, inner membrane subunit CysT; sulfate ABC
FT                   transporter, inner membrane subunit; manually curated;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: sulfate ABC transporter,
FT                   permease protein; sulfate ABC transporter, permease protein
FT                   CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47073"
FT                   /db_xref="GOA:E6S997"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S997"
FT                   /protein_id="ADU47073.1"
FT                   /translation="MEARTAQARTVRPGSPAHGPAPGRAGRSRRRLRSGLQPLGIGVVT
FT                   LWLSVIVLLPLAALTVASFEGGLGGFWDAATAPVALASLRVTVTVSAIVAAVNAVLGTL
FT                   VAWVLVRDRFAGQAVVNALIDLPFALPTIVASIVLLSLYGPGSPVGVQLNATTWGLFVA
FT                   LAFVTLPFVVRSVQPVLIEADREVEEAAASLGATNWTTFRRIVLPTLAPAVLSGTGLAF
FT                   ARAIGEYGSVVLIGGNIPRETQVASQYIQQQIEMDRPANAAAVSVVLLLIAFATLLVLR
FT                   VLSTRSQRREERAP"
     gtggaggcgc ggaccgccca agcgaggacc gtacggccgg ggagccctgc gcacggtccg        60
     gctccagggc gggccggcag gtcccgccgg cggctgcgca gcgggctgca accgctcggg       120
     atcggggtcg tgacgctctg gctcagcgtc atcgtgctgc tgcccctcgc cgccttgacc       180
     gtcgcatcgt tcgagggcgg cctcggtggt ttctgggacg cggcgactgc accggtcgcc       240
     ctcgcatcac tccgagtcac cgtgacggtg tcggccatcg tcgccgctgt caacgccgtc       300
     ctgggcaccc tcgtcgcctg ggtgctggtc cgcgaccgct tcgccggtca ggcagtggtc       360
     aacgccctca tcgacctgcc gttcgccctg cccaccatcg tcgcgagcat cgtgctcctc       420
     tcgctctacg gcccgggcag cccggtcggc gtccagctca acgcgaccac gtggggcctc       480
     ttcgtggccc tcgccttcgt caccctcccc ttcgtcgtcc gctcggtaca gccggtgctc       540
     atcgaggcag accgggaggt cgaggaggcc gccgcctcgc tcggcgcgac caactggacc       600
     accttccgcc ggatcgtcct gcccaccctc gcccctgccg tcctcagcgg caccgggctg       660
     gcgttcgcgc gggccatcgg cgagtacggc tccgtcgtgc tcatcggcgg caacatcccg       720
     cgggagaccc aggtcgcctc ccagtacatc cagcagcaga tcgagatgga ccgcccggcc       780
     aacgcggcgg ccgtctccgt ggtgctgctg ctcatcgcct tcgcgaccct gctcgtgctg       840
     cgggtgctgt cgacccggtc gcagcgccga gaggagcggg ccccgtga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page