(data stored in ACNUC7421 zone)

EMBL: CP002343.PE514

CP002343.PE514       Location/Qualifiers
FT   CDS_pept        complement(570008..573001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0531"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR010259: IPR000209: IPR003137: IPR007280;
FT                   KEGG: kfl:Kfla_2384 protease-associated PA domain protein;
FT                   PFAM: peptidase S8 and S53 subtilisin kexin sedolisin;
FT                   proteinase inhibitor I9 subtilisin propeptide;
FT                   protease-associated PA domain protein; peptidase domain
FT                   protein; SPTR: Protease-associated PA domain protein; PFAM:
FT                   PA domain; Peptidase inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47076"
FT                   /db_xref="GOA:E6S9A0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A0"
FT                   /protein_id="ADU47076.1"
FT                   /translation="MKRRLLGAVTAVPVALAMAGTGAADAAVTQSVPPSTSGTYIVQMA
FT                   DLPVVAYDGKIKGLAATSPTPGTKVDPQSDAVTRYVAHLESKHNSALTRVGATSTKIYD
FT                   YAFSFNGFAAKLTAAQAQRLTKAPGVVAVNPEQTYTVDTSTTPDFLGLTAKGGLWDQLG
FT                   GTGSAGEDILIGTIDSGIWPEHLSFSDRATAGVPSASGPVVYAPFDGPADACKAGENWT
FT                   AKTCNNKLVIARHFNESWGGDKGIRKDRPWEFTSPRDYNGHGTHTASTSGGNHDVPVPG
FT                   IASALAPNGMSGIAPRARVAAYKALWSTETGDTASGRGGDLVAAIDQAVADGVDVINYS
FT                   ISGSQTNFADGAEIAFLFAARAGVFVAASAGNSGPTASTVAHPSPWITTVAAGTHNRAS
FT                   HGSVTLGNGATYEGASLAAEAVTAPFIDSTSAGLAGADPTKVALCYSSADGGNVLDPAK
FT                   VAGKIVLCDRGATARTNKSLAVKEAGGVGLVLVNTSPIGINADLHTIPSVHLESTERAP
FT                   VKAYAATSGATATINVAELDLNAPAPFTAGFSSRGPLSAGSGDLLKPDVIAPGQDILAA
FT                   YTPVTNGGYAYNAISGTSMSSPHVAGLAALLRDRHPGWSPMAIKSALMTTDYDVKDEAS
FT                   TADKAFRQGAGHVNPNAAAKAGLVYDSGWNDWLAFLCGTTSAVGAGTCDALVSRGYSTD
FT                   PSQFNGASIASGALAGSETITRRVTNVGATTATYKASITLRGFDVEVSPKKLVLAPGQT
FT                   KSFTVTITREDAPLNSYTGGHLVWTSGTTTVRSPIVVRPVALAAPGEVRAEPSGTSYGV
FT                   TFGYTGDFAATGRGLVPAAATSGTVADDPTDSTCSLSSPNAQKVEVAVPAGTTYARFAL
FT                   FDADVNPGTDLDLCVFDSTEKNVGSSGSGTSAEQVNLLNPGAGTYTVVVQGWGVAGTSP
FT                   FKLHTWVLGSAAEDNLTVTAPTSATIGQSGTVTLGFTGLTSGKWLGSVAYSGAEGMPNP
FT                   TIVRVDVP"
     atgaagcgaa ggttgctggg cgcggtcacc gccgtgccag ttgcgctcgc catggccggg        60
     acaggcgccg ccgatgcagc ggtcacgcag tccgtgccac cgagcaccag cgggacgtac       120
     atcgtgcaga tggcggacct cccggtcgtc gcgtacgacg ggaagatcaa gggcctcgcg       180
     gccaccagcc cgaccccggg cacgaaggtc gacccgcagt ccgatgcggt caccaggtat       240
     gtcgcccacc tcgagtcgaa gcacaactcg gctctcaccc gggtgggggc aaccagcacc       300
     aagatctacg actacgcgtt ctcgttcaac ggcttcgcgg ccaagctgac ggcagcccag       360
     gcgcagcggc tcaccaaggc gcccggggtc gtcgcggtca acccggagca gacctacacg       420
     gtcgacacgt cgacgacgcc cgacttcctc ggcctgaccg ccaagggcgg cctgtgggac       480
     cagctcggtg gcaccggaag cgccggggag gacatcctca tcggcacgat cgactctgga       540
     atctggccgg agcacctcag tttctcggac cgcgccactg caggcgtgcc ctccgcctcg       600
     ggcccggtcg tctacgcacc cttcgacggc ccggccgacg cctgcaaggc tggggagaac       660
     tggaccgcca agacctgcaa caacaaactc gtcatcgccc gccacttcaa cgagagctgg       720
     ggtggcgaca aggggatccg caaggaccgg ccctgggagt tcacctcccc ccgtgactac       780
     aacggtcacg gcacccacac cgccagcacc tccggcggca accacgatgt gcctgttccc       840
     ggcatcgcca gcgccttggc tcccaacggc atgagcggca tcgccccgcg cgcccgcgtg       900
     gccgcctaca aggccctctg gtcgaccgag accggcgaca cggcgagcgg tcgcgggggt       960
     gacctcgtcg cggcgatcga ccaggccgtg gcggacggcg tcgacgtcat caactactcg      1020
     atcagcggct cccagacgaa cttcgccgac ggcgccgaga tcgcgttcct cttcgcggcc      1080
     cgggccggtg tcttcgtcgc ggcgtccgcc ggcaacagcg gcccgaccgc ctcgaccgtc      1140
     gcccacccgt ccccgtggat caccacggtc gcggcaggca cccacaaccg ggccagccac      1200
     ggctcggtga ccctcggcaa cggcgcgacc tacgagggcg cgtccctggc ggcagaggcc      1260
     gtgaccgcgc cgttcatcga ctccacctcg gcgggcctgg ctggtgcgga cccgaccaag      1320
     gtcgcgctct gctactcgag cgccgacggg ggcaacgtcc tcgacccggc caaggtcgcg      1380
     ggcaagatcg tcctgtgcga ccgcggtgca accgcccgga cgaacaagag cctcgcggtc      1440
     aaggaggcgg gcggcgtggg cctggtcctc gtcaacacct cgccgatcgg gatcaacgcg      1500
     gacctgcaca cgatcccgtc ggtccacctc gagtcgaccg agcgcgcgcc cgtcaaggcg      1560
     tatgcggcca cgtccggtgc gacggccacg atcaacgtgg ccgagctcga cctcaacgcc      1620
     cccgcgccgt tcacggccgg cttctcgtcc cgcggaccgc tgagtgcggg cagcggtgac      1680
     ctcctcaagc cggacgtcat cgcgcccggc caggacatcc tcgcggccta caccccggtg      1740
     accaacggtg gctacgccta caacgccatc tcggggacct cgatgtcgag cccgcacgtc      1800
     gccgggctcg cggcgctgct ccgtgaccgg caccccggct ggtcgccgat ggcgatcaag      1860
     agcgcgctca tgacgaccga ctacgacgtc aaggacgagg cgagcacggc tgacaaggca      1920
     ttccgccaag gcgccggcca tgtcaacccc aatgccgccg cgaaggccgg cctggtctac      1980
     gacagcggct ggaacgactg gctcgccttc ctctgcggca ccacgtccgc ggtcggcgca      2040
     ggcacgtgcg acgcgctggt gagtcggggc tactcgacgg acccgagcca gttcaacggt      2100
     gcctcgatcg ccagcggcgc cctcgccggt tccgagacga tcacccgccg cgtgacgaac      2160
     gtcggggcga cgacggcaac ctataaggcg tcaatcaccc tgcgcggctt cgacgtcgag      2220
     gtctcgccga agaagctggt cctcgccccc gggcagacga agtccttcac ggtgaccatc      2280
     acgcgggagg atgcaccgct caacagctac accggcggcc acctcgtctg gacgagcggc      2340
     accacgacgg ttcgctcgcc gatcgtcgtg cgtccggtcg ccctcgcggc accgggtgag      2400
     gtcagggccg agccctcggg cacgagctat ggcgtcacct tcggctacac cggtgacttc      2460
     gccgccacgg gccggggcct cgtccccgcg gccgcgacga gcggcaccgt cgccgacgac      2520
     ccgacggact cgacgtgctc cctgagctcg ccgaacgccc agaaggtcga ggtcgccgtc      2580
     ccggccggca cgacgtacgc gcggttcgcc ctcttcgacg cggacgtcaa ccccggcacg      2640
     gacctcgacc tgtgcgtctt cgactcgacg gagaagaacg tgggttccag cggatccgga      2700
     acgtcagcag agcaggtcaa cctgctcaac ccgggcgcgg gcacctacac ggtggtcgtc      2760
     cagggctggg gggtagccgg cacctcgccg ttcaagctgc acacgtgggt cctcgggtcc      2820
     gccgcggagg acaacctgac ggtcactgcg cccacgtcgg ccacgatcgg ccagtccggg      2880
     acggtcacgc tcgggttcac cggcctgacg agtggcaagt ggctcggctc ggtcgcctac      2940
     tccggcgccg aggggatgcc gaacccgacc atcgtgcgcg tcgacgtccc gtga            2994
//

If you have problems or comments...

PBIL Back to PBIL home page