(data stored in ACNUC7421 zone)

EMBL: CP002343.PE515

CP002343.PE515       Location/Qualifiers
FT   CDS_pept        complement(573173..575170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0532"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1205 Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster; InterPro IPR014021: IPR001650: IPR011545:
FT                   IPR014001; KEGG: nca:Noca_0370 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; SPTR: Putative
FT                   ATP-dependent RNA helicase; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47077"
FT                   /db_xref="GOA:E6S9A1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A1"
FT                   /protein_id="ADU47077.1"
FT                   /translation="MNGSDALFNAPPAPSDDGDRDQRAFDPEALLHRLVGEHPERLLHV
FT                   HEVPARPARHAEWPGWVDPTLLGALLGSGIDRPWRHQVEVAEAAHRGDHVVVSTGTASG
FT                   KSLGYLLPLLTDVVTGARAPSGRGSTALYLAPTKALAADQLDRITRLALPPVRAATYDG
FT                   DTPTDERRWIRDHANVVLTNPDLVHHSLLPRHDRWAPFLRALRYVVVDECHVYKGVFGA
FT                   HLAAVLRRLRRVAARYHASPTFVFASATVADPSVHASRLLGMPLSSVTEDGSPRAPMTF
FT                   ALWEPPVRTDDQGRPKRVSTLTETGDLLAQCVEEDVQTAVFARSRAGVEVVANVARDRV
FT                   STTREARIAAYRGGYLPEERRELERALRSRRLVGIAATNALELGVDVSGLDAVVLAGWP
FT                   GTLASLWQQAGRAGRTGHRSLAILVAADDPLDTFVVHHPESIFGRAVEATVVDPDNPYV
FT                   LGPHLAAAAAELPLTEGDLELFGPQTRPLLDALVAKGILKKRPRGWFWTREDRPADHVS
FT                   LRGAGEPVRIVETRTGRVVATVDEASAHAQVHTGAVHLHQGQTWVVTELDLDDGAAFAV
FT                   RGDPGWTTHAQSVSEFTIVRELEAVEWGPLRCSFGQVTVTHQVVSFLRRLPGGEVLGEH
FT                   PLDLPPRSLATKAMWWTLLDLTLSRAGSRR"
     atgaacgggt ctgacgcgct gttcaacgca cccccggctc cgtcggacga cggcgaccgg        60
     gaccagcgcg ccttcgaccc ggaggccctc ctgcaccgct tggtcggcga gcacccggag       120
     cggctgctcc acgtccacga ggttccggct cggccggcgc gccacgccga gtggccgggc       180
     tgggtggacc cgaccctcct cggtgccctc ctcgggtccg ggatcgaccg gccgtggcgc       240
     caccaggtcg aggtcgcgga ggccgcccac cgcggcgacc acgtcgtcgt ctcgacgggc       300
     acggcctccg gcaagagcct cggctacctt ctgcccctcc tcaccgacgt cgtgaccggc       360
     gctcgggcgc ccagtggtcg cgggtccacg gcgctctatc tcgcccccac caaggcgctc       420
     gccgcggacc agctcgaccg gatcacccgg ctcgcccttc ccccggtgcg ggccgccacg       480
     tacgacggcg acaccccgac cgacgagcgg cgctggatcc gcgaccacgc gaacgtcgtg       540
     ctcaccaacc cggacctcgt ccaccactcg ctgttgccgc ggcacgaccg gtgggcccct       600
     ttcctccggg ccctccgcta cgtcgtcgtc gacgagtgtc acgtctacaa gggcgtcttc       660
     ggcgcccacc tcgcggcggt cctccggcgg ctgcggcgag tggccgcgcg ctaccacgcc       720
     tccccgacgt tcgtcttcgc ctccgccacc gtggccgacc cctccgtcca cgcctcccga       780
     cttctcggta tgccgctgag ctcggtcacc gaggacggct cccctcgggc gccgatgacc       840
     ttcgccctct gggagccccc ggtccgcacc gacgaccagg gccgcccgaa gcgggtgagc       900
     acgctgacgg agaccggcga cctcctggcg cagtgcgtcg aggaggacgt gcagaccgcc       960
     gtcttcgccc ggtcccgcgc cggcgtggag gtcgtggcca acgtcgcccg cgaccgagtg      1020
     agcacgaccc gggaagcgcg catagcggca taccgcggcg gctacctgcc ggaggagcgg      1080
     agggagctcg aacgcgccct ccggtcgcgc cggctcgtcg gcatcgccgc gacgaacgcg      1140
     ttggagctcg gcgtcgacgt cagcggtctc gacgccgtcg tgctcgccgg ctggcccggc      1200
     accctcgcct cgctctggca gcaggcgggc cgcgccggcc gcaccgggca ccgctcgctc      1260
     gcgatcctcg tcgcggccga cgacccgctc gacaccttcg tcgtccacca ccccgagagc      1320
     atcttcggcc gcgccgtcga ggcgacagtc gtcgaccccg acaaccccta cgtgctcggg      1380
     ccgcatctcg ccgccgccgc cgcggagctg cccctgacgg agggggacct cgagctcttc      1440
     gggccgcaga cccggcccct gctcgacgcc ctcgtcgcca aggggatcct caagaagcgg      1500
     ccgcgcggct ggttctggac gcgggaggac cgccctgccg accacgtgtc gctccgcggc      1560
     gccggtgagc cggtccggat cgtcgagaca cggaccgggc gcgtcgtcgc caccgtcgac      1620
     gaggcctcgg cccacgccca ggtgcacacc ggggccgtgc acctgcacca gggccagacg      1680
     tgggtcgtca ccgagctcga cctcgacgac ggggcggcct tcgccgttcg gggcgacccc      1740
     gggtggacga cgcacgccca gtcggtgagc gagttcacca tcgtccgcga gctcgaggcg      1800
     gtcgagtggg ggccgctccg gtgctcgttc ggccaggtca ccgtcacgca ccaggtcgtc      1860
     tcgttcctcc ggcggctgcc gggtggcgag gtgctcgggg agcatccgct cgacctgccg      1920
     ccgcggtccc tcgcgacgaa ggcgatgtgg tggaccctgc tcgacctgac cctgagccgg      1980
     gccggctcgc gccgttga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page