(data stored in SCRATCH zone)

EMBL: CP002343.PE517

CP002343.PE517       Location/Qualifiers
FT   CDS_pept        575706..577226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0534"
FT                   /product="methyltransferase small"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR007848: IPR002052; KEGG:
FT                   kse:Ksed_25140 methyltransferase family protein; PFAM:
FT                   methyltransferase small; SPTR: Putative transferase; PFAM:
FT                   Methyltransferase small domain; TIGRFAM: HemK family
FT                   putative methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47079"
FT                   /db_xref="GOA:E6S9A3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A3"
FT                   /protein_id="ADU47079.1"
FT                   /translation="MVEQSGSPSPAPPVVDPALVARLRADLASAGFTVDGVAERLGPVA
FT                   AAALRREQRLPALLATAAPLDPVAALVRFFTLGQPVARADLEAALPTLRVEGVAALRLA
FT                   RLKGDEVVATCDLRPYAEDAHDWWVASDLSELATRAPLRPDHVLGIGGASTTLATWTIR
FT                   HRVDRALDLGTGCGVQALHLAGHTGSIVATDISERALAFARFNAALAGLDVDLRRGDLL
FT                   DPVAGERFSLIVSNPPFVITPRADDVPVYEYRDGGRSGDAIVRTLVRTVRDALEPGGVA
FT                   QLLGNWEVPHGRTWRDVWGDWLAGIDLDAWVVQREVQDPAEYAELWSRDGGVVPGSSAH
FT                   ERLGAAWLRDFASRDVEAIGFGVVTLQRPLTERRPWRSLDEAPGPVAAQMGPVIEAGLR
FT                   ARTWLAEHTDEDVLAVAWACAADVTEERHGRPGADDPSVIIVRQGGGLRRAVRAGTLLA
FT                   AYLGVADGELAAATALDAIATVLGLDPAAVRAELVPQIRDLVADGLLT"
     gtggtcgagc agtcaggctc cccgtcgccg gcaccgccgg tcgtcgaccc agccctcgtg        60
     gcccggttgc gggcggacct ggcctcggcg ggcttcaccg tggacggggt cgccgagcgg       120
     ctcggacccg tcgcggcggc cgcgctccgc cgggagcagc gcctgccggc cctgctcgcg       180
     accgctgctc cgctcgaccc ggttgccgcc ctggtccgct tcttcaccct ggggcagccc       240
     gtggcccgag cggatctcga ggccgccctg ccgacgctcc gggtcgaggg ggtcgctgcc       300
     ctgcggctgg cccgtctcaa gggggacgag gtcgtggcga cgtgcgacct gcggccctac       360
     gccgaggacg cccacgactg gtgggtcgcc tccgacctgt ccgagctggc gacgcgcgca       420
     ccgctccgcc cggaccacgt cctcggcatc ggcggcgcct cgacgacgct cgccacctgg       480
     accatccgac atcgcgtgga ccgggccctc gacctcggca ccggctgcgg agtgcaggcg       540
     ctgcacctgg ccggccacac cgggtcgatc gtcgccacgg acatctcgga gcgggcgctc       600
     gccttcgccc gcttcaacgc cgcgttggcc gggctcgacg tcgacctgcg tcgcggagac       660
     ctgctggacc ctgttgcggg agagcggttc tcgctgatcg tgtccaaccc gccgttcgtc       720
     atcaccccgc gcgccgacga cgtgcccgtc tacgagtacc gggacggcgg gcgctcgggc       780
     gacgccatcg tccgcaccct cgtacggacc gtccgcgacg ccctcgagcc gggtggggtc       840
     gcccagctcc tcggcaactg ggaggtgccc cacggtcgca cctggcgcga cgtctggggc       900
     gactggctcg ccgggatcga tctcgacgcg tgggtcgtcc aacgggaggt ccaggacccg       960
     gccgagtacg cggagctgtg gagccgcgac ggcggtgtcg tccccggctc gagcgcgcac      1020
     gagcggctcg gcgcggcctg gctgcgcgac ttcgcctccc gcgacgtcga ggcgatcggc      1080
     ttcggcgtcg tcaccctcca gcggccgctg accgagcgcc ggccgtggcg ctccctcgac      1140
     gaggcacctg gtccggtggc ggcgcagatg ggtcccgtca tcgaggcggg gctccgggcc      1200
     cgcacctggc tggccgagca cactgacgag gacgtcctcg ctgtggcatg ggcgtgcgcc      1260
     gcggacgtga ccgaggaacg gcacggtcgc cccggcgcgg acgacccgtc cgtcatcatc      1320
     gtccgccagg gtgggggcct gcgccgcgct gtccgggcgg ggaccctcct ggcggcctat      1380
     ctcggcgtgg ccgacgggga gctggcggcg gccaccgccc tcgacgcgat cgcgacggtc      1440
     ctcgggctcg accccgcggc ggtccgggcc gagctggtcc cgcagatccg cgaccttgtc      1500
     gccgacggcc tgctcacctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page