(data stored in ACNUC7421 zone)

EMBL: CP002343.PE518

CP002343.PE518       Location/Qualifiers
FT   CDS_pept        577440..578081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0535"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: tpr:Tpau_2624
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; SPTR: Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47080"
FT                   /db_xref="GOA:E6S9A4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A4"
FT                   /protein_id="ADU47080.1"
FT                   /translation="MATTAARAAPLPPTERREALIDVFLDLARRHGRVPTTSEIAGAAG
FT                   VAEGTIFRVFPSKDALQTAAVEAAFCPASARRDFVAIDRSQPMRDRLVAFAASLQRRIR
FT                   DVLDLMGALGLSQPPPLHQHAACLETGRHVPSEPSADCAALHVDLFEAVLDLVDPDAIT
FT                   VTPHQLLHRIRLLSFSGSHPGIAHGELLTPEEVVDTVLYGVCARPGPIRD"
     atggccacca ccgcggcgcg cgccgcgccc ctgccgccca ccgagcggcg cgaagccctc        60
     atcgacgtct tcctcgacct cgcaaggcgg cacggacggg tcccgacaac gagcgagatc       120
     gccggtgcgg cgggggttgc cgaggggacg atcttccggg tcttcccgag caaggacgcg       180
     ctccagaccg cggccgtcga ggccgccttc tgcccagcgt cggcacgtcg cgacttcgtc       240
     gccatcgacc ggtcgcagcc gatgcgggac cggctcgtcg ccttcgcggc ctcgctccag       300
     cggcggatcc gcgacgtcct cgacctgatg ggcgccctcg gcctgagcca gccgccgccc       360
     ctccaccagc acgccgcctg cctcgagaca ggccggcacg tgccctccga gcccagcgct       420
     gactgcgcgg ccctgcacgt cgacctcttc gaggcggtgc tcgacctcgt cgaccccgac       480
     gcgatcacgg tgacgccaca ccagctgctc caccgcatcc ggctgctcag cttctcgggc       540
     agccaccccg gcatcgccca cggcgagctg ctcacccccg aggaggtcgt ggacaccgtc       600
     ctctacggcg tctgcgcccg ccccggcccg atccgcgact ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page