(data stored in ACNUC7421 zone)

EMBL: CP002343.PE519

CP002343.PE519       Location/Qualifiers
FT   CDS_pept        578149..579879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0536"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR003439:
FT                   IPR017940: IPR001140: IPR003593: IPR 017871; KEGG:
FT                   kfl:Kfla_3612 ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase; SPTR: Putative ABC transporter; PFAM:
FT                   ABC transporter transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47081"
FT                   /db_xref="GOA:E6S9A5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A5"
FT                   /protein_id="ADU47081.1"
FT                   /translation="MLLRLLRSHLLAYRGEITLIVLLQLASTIASLYLPSLNGEIIDDG
FT                   VAKGDTDFIMSHGALMLGVSVVQIATAVAATFLAARVAMGIGRDLRAKVFDTVIDYSAQ
FT                   EVSRFGAPTLISRNTNDVTQVQTVLFMGFAILVSTPIMMFGGIIMALREDVGLSWLVAV
FT                   AVPLLGLVVATVIWRMMPWFTRMQTSLDGVNRVLREQITGIRVVRAFVREGHEEARFGR
FT                   ANADLTEAGLRVGRLMALVFPVVMFIFSMSTVAVLWFGAYRVDSGAMEVGSLTAFLAYL
FT                   VQILMAVMMATFMATMIPRASVSAGRIAEVLDTASSIVQSVQPIPIRVPRAGVEFVDVE
FT                   FHYPGAEHAVLNGITFEASSGRTTAIIGSTGAGKTTLLGLVPRLFDVRSGRVKVGDVDV
FT                   RDLELDALWARIGLVPQKPYLFTGTVASNLRYGNPDATDDELWEALRISQAADFVTQLG
FT                   GLDTAIVQGGTNVSGGQRQRLAIARAVVKRPDIYLFDDSFSALDLSTDARLRAALRPVT
FT                   RDATVVIVAQRVSTIIDADHIVVLDDGRIVGQGTHDELLQTCETYQEIALSQRAAEEVA
FT                   "
     atgctcctcc gactgcttcg gagccacctg ctggcctacc ggggagagat cacgctcatc        60
     gtgctcctcc agctggccag caccatcgcc tcgctctacc tgcccagcct caacggcgag       120
     atcatcgacg acggggtcgc caagggggac accgacttca tcatgagcca cggggccctc       180
     atgctcggcg tgagcgtcgt gcagatcgcc accgcggtcg ccgccacctt cctcgccgcg       240
     cgcgtcgcca tgggcatcgg gcgggacctg cgggcgaagg tgttcgacac cgtcatcgac       300
     tactcggcgc aggaggtctc ccgcttcggc gccccgaccc tcatctcgcg caacaccaac       360
     gacgtcaccc aggtgcagac cgtcctcttc atggggttcg ccatcctcgt gtcgaccccg       420
     atcatgatgt tcggcgggat catcatggcg ctccgcgagg acgtcgggct ctcctggctc       480
     gtcgccgtcg ccgtgccgct gctcggcctc gtcgtcgcca cggtcatctg gcggatgatg       540
     ccctggttca cccggatgca gacctcgctc gacggcgtca accgggtcct ccgcgagcag       600
     atcaccggca tccgggtcgt gcgggccttc gtgcgcgagg gccacgagga ggcgcggttc       660
     ggccgggcca acgccgacct caccgaggcc gggctgcgcg tcggccggct catggcgctc       720
     gtcttccccg tcgtgatgtt catcttcagc atgtcgaccg tggcggtgct gtggttcggc       780
     gcctaccgcg tcgacagcgg tgcgatggag gtgggctcgc tcacggcctt cctcgcctac       840
     ctcgtccaga tcctcatggc cgtcatgatg gcgaccttca tggcgacgat gatcccccgc       900
     gcgtcggtct cggccgggcg catcgccgag gtcctcgaca cggcctcgtc catcgtccag       960
     tcggtgcagc cgatcccgat ccgggtgccg cgagccggcg tcgagttcgt cgacgtcgag      1020
     ttccactacc ccggcgccga gcacgccgtc ctcaacggca tcaccttcga ggcgtcgtca      1080
     ggccgcacga ccgcgatcat cgggtcgacc ggcgcgggca agacgaccct gctcggactc      1140
     gtcccgcggc tcttcgacgt ccgctccggc cgcgtcaagg tcggcgacgt cgacgtccgt      1200
     gacctcgagc tcgacgcgct ctgggcccgc atcgggctcg tgccgcagaa gccctacctg      1260
     ttcaccggca ccgtggcgag caacctgcgc tacggcaacc cggacgcgac cgacgacgag      1320
     ctctgggagg cgctgcgcat cagccaggcc gcggacttcg tcacgcagct cggcgggctc      1380
     gacaccgcga tcgtccaggg agggaccaac gtctcgggcg gccagcggca gcggctcgcc      1440
     atcgcgcggg ccgtcgtcaa acggcccgac atctacctct tcgacgactc gttctccgcc      1500
     ctcgacctgt cgaccgacgc acgactccgg gctgcgctcc gaccggtgac ccgcgacgcg      1560
     acggtcgtca tcgtggccca gcgcgtgtcg acgatcatcg acgccgacca catcgtcgtc      1620
     ctcgacgacg gacggatcgt cggtcagggc acccacgacg agctgctcca gacctgtgag      1680
     acctaccagg agatcgccct gtcccagcgt gcagcggagg aggtggcctg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page