(data stored in ACNUC7421 zone)

EMBL: CP002343.PE522

CP002343.PE522       Location/Qualifiers
FT   CDS_pept        585353..586363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0539"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="COGs: COG0598 Mg2+ and Co2+ transporter; InterPro
FT                   IPR002523; KEGG: rxy:Rxyl_0057 magnesium and cobalt
FT                   transport protein CorA; PFAM: Mg2 transporter protein CorA
FT                   family protein; SPTR: Magnesium and cobalt transport
FT                   protein CorA; PFAM: CorA-like Mg2+ transporter protein;
FT                   TIGRFAM: magnesium Mg(2+) and cobalt Co(2+) transport
FT                   protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47084"
FT                   /db_xref="GOA:E6S9A8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A8"
FT                   /protein_id="ADU47084.1"
FT                   /translation="MIIDCALYRDGRRQQEAALTLDTAAALHQDGSEGFAWLGTFEPAP
FT                   DELERIRDSFGLHELAVEDVQTFHLRPKMEQYDHGVELVILRTARYDDEREEVDFGEIS
FT                   VFIAPTFVITVRQGVASELHTARTNLEARPDLLAEGSPAVLWAILDQVIKSYGPVVAEL
FT                   ERDIEQVESTVFAGEAAPTERIYFLRREVTNFYRAVHPLLTVLTTIERTYREGPLAPYL
FT                   HDVHDYLRLISDEVAAQRDLLATILEANMAVISVEQTRLGIRQGQTIERLTVLATVFLP
FT                   LTFVTGFFGQNFPWLVEHLDGFGRFVVLGIGGLVLPLVVLWVLLRRDRGRLDRST"
     atgatcatcg actgtgccct gtaccgcgac gggcgacgcc agcaggaggc cgcgctcacg        60
     ctcgacacgg cggccgcgct gcaccaggac ggcagcgagg gcttcgcctg gctgggcacc       120
     ttcgaaccgg cgcctgacga gctggagcgc atccgcgaca gcttcggtct gcacgagctc       180
     gcggtcgagg acgtccagac gttccacctg cggcccaaga tggagcagta cgaccacggc       240
     gtcgagctcg tcatcctgcg cactgcccga tacgacgacg agcgcgaaga ggtcgacttc       300
     ggcgagatca gcgtgttcat cgcgcccacg ttcgtgatca ccgtgcgaca aggcgtggcg       360
     agcgagctgc acacggcgcg caccaacctg gaggcgcggc cggacctgct cgccgagggc       420
     agcccggcgg tgctctgggc gattctcgac caggtgatca agagctacgg tccggtcgtc       480
     gccgagctgg aacgcgacat cgagcaggtc gagagcaccg tcttcgccgg ggaggccgca       540
     cccacggagc ggatctactt cctgcggcgc gaggtgacca acttctaccg cgccgtccac       600
     ccgctgctca ccgtgctcac gacgatcgag cgcacgtacc gggagggtcc gctcgcgccc       660
     tacctccacg acgtccacga ctacctgcgg ctcatcagcg acgaggtggc cgcccagcgc       720
     gacctgctcg cgacgatcct cgaggcgaac atggccgtca tctccgtgga gcagacgcgg       780
     ctcgggatcc ggcagggtca gacgatcgaa cggctcaccg tcctcgccac cgtgttcctg       840
     ccgctcacct tcgtgaccgg gttcttcggc cagaacttcc cctggctcgt cgagcacctc       900
     gacgggttcg gccggttcgt ggtgctcggc atcggtgggc tggtcctgcc gctcgtcgtc       960
     ctctgggtgc tccttcgacg ggaccgcggg cgcctcgacc ggtccacctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page