(data stored in ACNUC7421 zone)

EMBL: CP002343.PE523

CP002343.PE523       Location/Qualifiers
FT   CDS_pept        complement(586568..587002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0540"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR015358: IPR010211; KEGG:
FT                   tcu:Tcur_2818 transcriptional regulator, MerR family; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR:
FT                   Transcriptional regulator, MerR family; TIGRFAM:
FT                   redox-sensitive transcriptional activator SoxR; PFAM: MerR
FT                   family regulatory protein; MerR, DNA binding; TIGRFAM:
FT                   redox-sensitive transcriptional activator SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47085"
FT                   /db_xref="GOA:E6S9A9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A9"
FT                   /protein_id="ADU47085.1"
FT                   /translation="MSPQLTIGQVAERTGVATSALRYWEALGLISSGRTTGNQRRYDRP
FT                   TIRRVSFIRAAQRVGLSLEEIRDALATLPGSRTPTSHDWARLSSAWRARLDEQIRRIEL
FT                   LRDRLDGCIGCGCLSLETCALNNPGDEMASVGPGPHRLDP"
     atgagcccac agctcaccat cggccaggtc gcggagcgca ccggcgtcgc gacgtccgcg        60
     ctgcgctact gggaggccct cgggctcatc tcctccggcc gcacgaccgg caaccagcga       120
     cgctacgacc ggcccacgat ccggcgcgtg tccttcatcc gggcagccca acgagtcggt       180
     ctgtcactcg aggagatccg ggacgccctg gccaccctgc ccggctcgcg caccccgacg       240
     tcccacgact gggccagact gtcctcggcc tggcgggcga gactcgacga acagatccgg       300
     cgcatcgaac tgctccgcga ccgcctcgac ggctgcatcg gctgcggctg cctcagcctg       360
     gagacgtgcg cgctcaacaa cccgggtgac gagatggctt cggtcgggcc cggaccgcac       420
     cgcctcgacc cctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page