(data stored in SCRATCH zone)

EMBL: CP002343.PE524

CP002343.PE524       Location/Qualifiers
FT   CDS_pept        complement(587004..587567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0541"
FT                   /product="phosphotransferase (aminonucleoside antibiotic
FT                   resistance)"
FT                   /note="KEGG: aoe:Clos_0772 phosphotransferase
FT                   (aminonucleoside antibiotic resistance); SPTR:
FT                   Phosphotransferase (Aminonucleoside antibiotic resistance);
FT                   PFAM: Chloramphenicol phosphotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47086"
FT                   /db_xref="GOA:E6S9B0"
FT                   /db_xref="InterPro:IPR012853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B0"
FT                   /protein_id="ADU47086.1"
FT                   /translation="MTDRLPLPASVDTPQTIVVTGVMAAGKSTVSQLLAERFTRAVHLR
FT                   GDEFRRVVVRGRVDLSPHGDLEAERQLALRHRLAAHTANIYVDAGFTVVVQDLFVGTTL
FT                   EPFLAQLTEPVSLVMLAPDVSTVMRRESERTKTGYGDLWSIRDFDLKVRTETPKIGLWL
FT                   DSSQQTPDETVDEILHRLAEARIR"
     gtgacggatc ggctccccct cccggcctcc gtcgacacgc cgcagaccat cgtcgtgacg        60
     ggcgtcatgg ccgctggcaa gtcgactgtc tcccagctgc tcgccgagcg cttcaccagg       120
     gccgtgcacc tgcgcggtga cgagttccgg cgcgtcgtcg tgcgcggacg cgtcgacctc       180
     agcccccacg gcgacctcga ggccgagcga cagctcgccc tgcgccaccg gctcgccgcg       240
     cacacggcga acatctacgt cgacgcaggg ttcaccgtgg tggtccagga cctcttcgtg       300
     gggacgaccc tcgagccgtt cctggcccag ctcaccgagc cggtgagcct cgtcatgctc       360
     gcgccggacg tctcgacggt gatgcggcgc gagtccgaac ggaccaagac gggctacggg       420
     gacctgtggt cgatccgcga cttcgacctc aaggtgcgga ccgagacgcc gaagatcggc       480
     ctctggctcg acagctcgca gcagacgccg gacgagaccg tggacgagat cctccaccgg       540
     ttggcggagg caaggatccg ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page