(data stored in ACNUC7421 zone)

EMBL: CP002343.PE525

CP002343.PE525       Location/Qualifiers
FT   CDS_pept        complement(587653..588471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0542"
FT                   /product="Forkhead-associated protein"
FT                   /note="InterPro IPR000253; KEGG: kfl:Kfla_5978 FHA domain
FT                   containing protein; PFAM: Forkhead-associated protein;
FT                   SMART: Forkhead-associated protein; SPTR: FHA domain
FT                   containing protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47087"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B1"
FT                   /protein_id="ADU47087.1"
FT                   /translation="MTVTCPNGHPSQADDYCDVCGSPIEAGAGSGDAASVSGSASPTGP
FT                   YAAGPAPTAAPGAAPAETSSVAGAESLECPNCQAQNPAGALFCEACGYDFTTGAMPRSS
FT                   AQNVPAPTPSSVQNAPAPTPSSVQNVPAPEGFDWLAEVWVDPDWYQTQEVEDPCPSPGL
FT                   PLIVPLRSRSVLLGRVSQSRNTHPEIDLSSDPGVSRRHAQLSTDGTRWFVEDLGSSNGT
FT                   FVGPASGPLPDDPISVGPRTELDDDDRLYVGAWSRVVVRRATPEEVEAHG"
     atgacggtca cgtgccccaa cggccacccg tcgcaggccg acgactactg cgacgtgtgc        60
     gggtcgccga tcgaggcggg cgccgggtcg ggtgacgcgg cctccgtgag cgggtcggcg       120
     agccccaccg gtccgtatgc cgctgggccc gctcccacgg cggcgcccgg agccgctccg       180
     gctgagacgt cctccgtggc gggtgccgag tcgctggagt gcccgaactg ccaggcgcag       240
     aaccctgccg gtgcgctgtt ctgcgaggcg tgcggctacg acttcacgac cggggcgatg       300
     ccacgttcga gcgcgcagaa cgtgccggcc cccaccccgt cgagtgtgca gaacgcgccg       360
     gcccccaccc cgtcgagtgt gcagaacgtg ccggcccccg agggcttcga ctggctcgcc       420
     gaggtctggg tcgacccgga ctggtaccag acgcaggagg tcgaggaccc ctgtccctcg       480
     ccgggtctgc cgctgatcgt gccgctccgc tcgcgcagtg tcctgctcgg acgcgtgagc       540
     cagagccgca acacccatcc cgagatcgac ctctcctccg accccggggt cagtcggcgg       600
     cacgcccagc tcagcaccga cggcacccgg tggttcgtcg aggacctcgg cagctccaac       660
     gggacgttcg tcgggccggc gtccggaccg ctgcccgacg acccgatcag cgtcggcccg       720
     cggaccgagc tggatgacga cgaccgactc tacgtcggag cctggagccg cgtcgtcgtg       780
     cgccgggcca ccccggaaga ggtcgaggcc cacggttga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page