(data stored in ACNUC7421 zone)

EMBL: CP002343.PE526

CP002343.PE526       Location/Qualifiers
FT   CDS_pept        complement(588468..589754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0543"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: kfl:Kfla_5977 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Putative
FT                   uncharacterized protein; PFAM: von Willebrand factor type A
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47088"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041176"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B2"
FT                   /protein_id="ADU47088.1"
FT                   /translation="MADFTAEVFQNEFLPDGGTDVHAIVRITSSGASAATSMGVVDPGS
FT                   AAEVILIDTSGSMGRRGVMEAGHAAKAALNEIVDGTLFAVVSGNGTAQIVYPYAHQGAL
FT                   AVMSSHTRAEARRAVEGLRAQGGTAMGTWLTLARQIFETVPHVQKRHAILLTDGVNEGE
FT                   TPASLQAAVQSCVGVFQCDARGVGDQWRVEEVRAIASALLGTVGLVPEPEELAAEFQAM
FT                   MRASMSRGVASAELRVWVPQGAELLFVRQVSPTLEDLTGRRSQVNPLTGAYPTGAWSDE
FT                   SRDYHVAVRLPARTLGQEQLAARVSLGLGDQPVCQGLVKARWSNDDALTTRIDPAVAAY
FT                   TGQAELAQVIQEGLAAKASGHDEVATAKLGRAVQLAGQTGNDEMTTRLKKVVEIDDADT
FT                   GTVRLKKSVSKLDEMSLDTASTKTSRVRR"
     atggctgact tcaccgccga ggtgttccag aacgagttcc tccccgacgg cgggaccgac        60
     gtccacgcga tcgtgcgcat cacctcgagt ggcgcctcgg ccgcgacgtc gatgggcgtc       120
     gtcgaccccg gctcggccgc tgaggtcatc ctcatcgaca cctccggctc gatgggccga       180
     cggggcgtca tggaggcggg ccacgccgcc aaggccgccc tcaacgagat cgtcgacggc       240
     accctcttcg ccgtcgtctc cggcaacggc accgcgcaga tcgtctaccc ctacgcccac       300
     cagggggcgc tcgcggtcat gtcgtcgcac acccgggcgg aggcgcgccg ggccgtcgag       360
     ggcctgcggg cgcagggcgg cacggcgatg ggcacctggc tcacgctcgc gcggcagatc       420
     ttcgagaccg tcccccacgt ccagaagcgc cacgcgatcc tcctcaccga cggcgtcaac       480
     gagggcgaga cgcccgcgtc gctgcaggcc gcggtccagt cgtgcgtcgg cgtcttccag       540
     tgcgacgcgc gcggcgtcgg ggaccagtgg cgcgtcgagg aggtccgcgc gatcgcctcg       600
     gccctgctcg gcaccgtcgg gctcgtgcct gagcctgagg agctggccgc cgagttccag       660
     gcgatgatgc gcgcgtccat gtcccggggg gtggccagcg ccgagctgcg cgtctgggtg       720
     ccgcagggcg ccgagctgct cttcgtgcgc caggtctcgc cgaccctcga ggacctcacc       780
     gggcgccggt cccaggtcaa cccgctgacc ggtgcctacc ccacgggcgc ctggtcggac       840
     gagagccggg actaccacgt cgccgtgcgg ctgcccgctc gcaccctcgg gcaggagcag       900
     ctcgcggcgc gggtctcgct cggcctcggc gaccagcccg tctgccaggg gctggtcaag       960
     gccaggtgga gcaacgacga cgccctgacg acccgcatcg acccggccgt cgccgcctac      1020
     acgggccagg ccgagctcgc ccaggtcatc caggaggggc tcgccgccaa ggcctccggc      1080
     cacgacgagg tggccacggc caagctcggt cgcgcggtcc agctcgcggg ccagaccggc      1140
     aacgacgaga tgacgacccg tctcaagaag gtcgtcgaga tcgacgacgc cgacaccggc      1200
     accgtgcggc tcaagaagag cgtctccaag ctcgacgaga tgtcgctcga cacggcctcg      1260
     acgaagacga gccgggtgcg ccgatga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page