(data stored in ACNUC7421 zone)

EMBL: CP002343.PE527

CP002343.PE527       Location/Qualifiers
FT   CDS_pept        complement(589747..591021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0544"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kfl:Kfla_5976 protein
FT                   serine/threonine phosphatase; PFAM: Protein phosphatase
FT                   2C-like; SMART: protein phosphatase 2C domain protein;
FT                   SPTR: Protein serine/threonine phosphatase; PFAM: Protein
FT                   phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47089"
FT                   /db_xref="GOA:E6S9B3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B3"
FT                   /protein_id="ADU47089.1"
FT                   /translation="MTDASPPRLPQATQFPQATGPEPTCPSCGTPNPPDASFCEACGAG
FT                   LAPGQQGAGASPAAYGGVVSPATPQTAPTGEESPLDVGWTGPVPSTATGPAQPTGAEAQ
FT                   PCQSCGEGHYVDGYCDHCGSPPPDPRNHFAESPAPWVGGVCDIGRRHARNEDAMALTAT
FT                   EAPGSRAVLVVCDGVSMATDSHIASLAAARAARAVLDQPLPRGAGTRDAWEAAAARALT
FT                   TAVATANDAVRSAVEGEQENPPSCTIAAAVIEDGAVVTGNVGDSRVYWLPDRPELPPRQ
FT                   LGRDDSYAHEQMLAGVPRDAAENGPHAHSITRWLGTDAPDDLTPHLTTLAADDTTAGWL
FT                   LVCSDGLWNYCSAAADMRVLVHNMVTEAGPDPTPTAVAQALVDFANEQGGRDNITVALA
FT                   RLGGQGSQETTGAEAAPQEGDPIHG"
     gtgaccgacg cctcgccgcc ccgcctgccg caggcgaccc agttccccca ggccaccggg        60
     ccggagccca cctgcccgtc atgtggcacc cccaatcccc ccgacgcgag cttctgcgag       120
     gcctgcggag ccggcctggc acccgggcag cagggagcgg gagcgagccc agcggcatac       180
     ggcggcgtgg tctccccagc caccccgcag acggcaccga cgggcgagga gtcccccctc       240
     gacgtcggtt ggaccgggcc cgtcccctcc accgcgacgg ggcccgccca gcccaccggc       300
     gccgaggcgc agccctgcca gagctgcggg gagggccact acgtcgacgg ctactgcgac       360
     cactgcgggt cacccccgcc ggacccgcgc aaccacttcg ccgagtcgcc ggccccgtgg       420
     gtcggcgggg tgtgcgacat cggccgacgg cacgcccgca acgaggacgc gatggcgctg       480
     accgccaccg aggcccccgg cagccgcgcg gtgctcgtcg tctgcgacgg cgtgtcgatg       540
     gccaccgact cccacatcgc ctccctcgcg gcggcccgtg ccgcccgcgc cgtcctcgac       600
     cagccactcc cgcgcggagc cgggacccgc gacgcgtggg aggcggccgc cgcccgggcc       660
     ctgaccactg cggtcgccac ggcgaacgac gccgtccgct ccgcggtcga gggggagcag       720
     gagaacccgc cgtcgtgcac catcgcggcc gccgtcatcg aggacggcgc cgtcgtgacc       780
     ggcaacgtcg gcgacagccg cgtctactgg ctgcccgacc gcccggagct cccgccgcgc       840
     cagctcggcc gggacgactc ctacgcccac gagcagatgc tggcgggcgt cccgcgcgac       900
     gccgccgaga acggcccgca cgcccactcg atcacccgct ggctcggcac cgacgccccg       960
     gacgacctca ccccgcacct cacgaccctc gctgccgacg acaccaccgc cgggtggctg      1020
     ctcgtctgct ccgacggact gtggaactac tgctccgccg ccgccgacat gcgggtcctc      1080
     gtgcacaaca tggtcaccga ggccgggccc gacccgaccc cgacggccgt ggcgcaggcg      1140
     ctcgtcgact tcgccaacga gcagggcgga cgcgacaaca tcacggttgc cctcgctcga      1200
     ctgggtgggc aaggatctca ggagacgacc ggcgcggagg ccgcgccaca ggaaggtgac      1260
     cccatccatg gctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page