(data stored in ACNUC7421 zone)

EMBL: CP002343.PE529

CP002343.PE529       Location/Qualifiers
FT   CDS_pept        complement(593498..594772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5974 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47091"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B5"
FT                   /protein_id="ADU47091.1"
FT                   /translation="MTLSGAVPPPPSSRPPEWTPPSAGPAGTRSGGSAAPAAPGGLGVP
FT                   VPAAEAQTYLTALRQWVAQRRADLSEVDSAILRLSSAEQTAITTDLTVALTFWKAINDR
FT                   LTLLETTFDGGRVGAKEAERLSTLIHGRLDSNTTEHLSLPATGSLAVSLPEACRLLDSL
FT                   TRTLQARASLAPGAAEATQRITVLRAGAERVRDQVPLVPAGPDRDDAAERLARLDRRVG
FT                   DLVERARRGADVGGLIGPLEIDLAVLERDLIVAAAERANAAQDRADTRQQVEELDARAE
FT                   AIRSLERRCIAAVTPAPHLAIPNVRALGPVPGEAAGLAGYRQRLDRVARALDLAHETYA
FT                   AALAERDEIIGLAGAVGAMLEARLAAHPPDDEVQDDLEAIRSRLEAVLGRTPMPTTRAR
FT                   ALAAAFQSYVDSVTRPPSRPGRAQQ"
     atgacgctgt ccggggccgt cccgccaccg ccctcgtcac ggccacccga gtggacacca        60
     ccgtcagccg gccccgcggg gacgcgttcc ggtggcagcg ctgccccggc ggctcccggg       120
     ggcctcggcg tgcccgtccc cgcagcggag gcccagacct acctcaccgc gctgcgtcag       180
     tgggtcgccc agcgtcgcgc ggacctcagc gaggtcgact ccgcgatcct ccggctctca       240
     tcggccgagc agacggcgat caccaccgac ctcaccgtcg cgctgacctt ctggaaggca       300
     atcaacgacc ggctcacgct cctcgagacc acgttcgacg gcggccgagt cggggcgaag       360
     gaggccgagc gactctcgac gctcatccac gggcggctcg actccaacac gaccgagcac       420
     ctgtcgctgc cggccaccgg atcgctcgcg gtgagcctcc ccgaggcctg tcgcctgctc       480
     gactccctca cccggaccct ccaggcgcgc gcgtcgctcg cgcccggtgc cgcggaggcg       540
     acccagcgga tcaccgtcct gcgggccggg gccgagcggg tccgcgacca ggtgcccctc       600
     gtgcccgccg gtcccgatcg ggacgacgcc gcggagcggt tggcgcggct cgaccgccgg       660
     gtcggcgacc tcgtcgagcg ggcccggcgt ggggccgacg tcggcggcct catcggtccg       720
     ctcgagatcg acctcgcggt gctcgagcga gacctcatcg tcgccgccgc cgaacgagcc       780
     aacgctgcgc aggaccgcgc cgacacgagg cagcaggtcg aggagctgga cgcgcgggcc       840
     gaggcgatcc ggtccctcga gcgccgctgc atcgccgcgg tgacaccggc gccgcacctc       900
     gccatcccca acgtccgcgc cctgggcccg gtgcccggtg aggccgccgg gctcgccggc       960
     taccgccaac gcctcgaccg ggtcgcccgc gcgctcgacc tcgcccacga gacgtatgcc      1020
     gccgcgctcg ccgagcgcga cgagatcatc ggcctcgccg gggcggtcgg ggcgatgctc      1080
     gaggcgcgac tggcggccca cccgcccgac gacgaggtcc aggacgacct ggaggcgatc      1140
     cggtcccggc tcgaggcggt gctcggccgg accccgatgc cgacgacacg agcccgggcc      1200
     ctggcggccg ccttccagtc ctacgtcgac tccgtgaccc gcccgccgtc ccgaccagga      1260
     agggcccagc agtga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page