(data stored in ACNUC7421 zone)

EMBL: CP002343.PE53

CP002343.PE53        Location/Qualifiers
FT   CDS_pept        complement(59909..62113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0053"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="InterPro IPR011600: IPR018247; KEGG: amd:AMED_1757
FT                   caspase-related protein; PFAM: peptidase C14 caspase
FT                   catalytic subunit p20; SPTR: Putative uncharacterized
FT                   protein; PFAM: Caspase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46615"
FT                   /db_xref="GOA:E6SEL4"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL4"
FT                   /protein_id="ADU46615.1"
FT                   /translation="MSGTRRALIVANDTYDHASLGQLRAPAADAEALADVLGDPEVGGF
FT                   TVTVVHNEPSYEVQSRIEDAFADSRPDDLLLLHFSGHGLKSDTGELFVAARNTRPDRLG
FT                   STAVSADFIQRCMKTSRARSIVLFLDCCYGGAFGEGVTVRAAGPVNVMDSFPAERLGGG
FT                   RGRAVISASSAIEYAFEGTALAADQTVRPSVFTSAVVEGLRTGDADRDEDGLVSLDELY
FT                   DYVFDRVRAENPKQTPGRDVEMAGDLYVARSRRRRLRPAPIPEAVAAALKEANPTFRRG
FT                   AVSELRDRLLHDDPAAALGALEALRDVVRTDTKSVADDAAAALASARMTVVPVSIDLGG
FT                   GGVGSEPRTGMVEVHGPALVQELTVQADPPLEAHVEDDGRVAVELPPGVEAFAGQLTIT
FT                   SPLGSVVVPVTASPASVAGAAEQATEPGSDETVRTTPQAETLVERRLTPVAAGAAAPVE
FT                   KAPTAAVEPPRSTAATESPLLSSRARRLVAATSALGGLLILASFTAPWVYGGVAEAQFP
FT                   GPTAGLFIVAVAATVVAIAVIVDQPRGLVATGLGLGVALVAATSLLTPFGMLATDATSM
FT                   PTGLLLGVAGELLVVTAGIVTLASLLGSGQVSGAWAGLPDRRGLVGLGIVLVGSVTLML
FT                   YAGWLSDRPGSTWGAIMIVWAVTWLAAGAVATSTRPAALARAFLAGWAITALSQPVSDM
FT                   QYQYNGETFPAQPVVLLALLGLVVWAAVPSRERPAVSHRE"
     atgagcggga cgcggcgcgc cctcatcgtg gcgaacgaca cctacgacca cgccagcctt        60
     ggccagctca gagcgccggc agcagatgcc gaggccctgg ccgacgtcct gggggacccg       120
     gaggtgggcg ggttcaccgt gaccgtcgtg cacaacgagc cgtcgtacga ggtccagagc       180
     cggatcgagg acgccttcgc tgacagccgc cctgatgacc tgctcctgct ccacttctcc       240
     gggcacggcc tcaagagcga caccggtgag ctgttcgtcg ccgcccggaa cacccggccg       300
     gaccggctgg gttcaacagc ggtgtccgca gacttcatcc agcggtgcat gaagacgtcg       360
     cgggcgcgca gcatcgtcct cttcctcgac tgctgctacg gcggcgcgtt cggtgagggc       420
     gtcaccgtgc gagcagccgg gccggtcaac gtgatggaca gcttccccgc cgagcggctc       480
     ggtggcggcc ggggccgggc ggtgatcagc gcctccagcg ccatcgagta cgcgttcgag       540
     gggaccgctc tggctgccga ccagacggtc aggccgtcag tcttcacgtc ggcggtggtc       600
     gaggggctgc gcaccggcga cgcggaccgg gacgaggacg gcctcgtctc actggatgag       660
     ctctacgact acgtcttcga ccgggtccgc gccgagaacc cgaagcagac cccgggtcgg       720
     gacgtggaga tggccggcga cctctacgtc gcccggagtc gacgacgccg gctgcgtccg       780
     gcgccgatcc ccgaagccgt cgcggccgcc ctgaaggagg ccaacccgac cttccgacgc       840
     ggagcggtga gcgagctccg ggaccgcttg ctccacgatg acccggccgc cgcactcggg       900
     gctctcgagg cgctgcgcga cgtcgtccgc accgacacga aatccgtcgc ggacgacgcc       960
     gcggcggccc ttgcctccgc tcggatgacc gtcgtgccgg tgtccatcga cctcggcgga      1020
     ggcggagtcg ggtcggagcc gcggaccggc atggtcgagg tgcacgggcc tgccctggtc      1080
     caggagctca cggtgcaggc ggatccgccc ctcgaggcgc acgtcgaaga cgacggccgg      1140
     gttgcggtgg agctgccccc tggtgtcgag gcgttcgccg gtcagctcac gatcacgagc      1200
     ccgctcgggt cagtcgtcgt cccggtgacg gcctcacccg catctgtcgc gggggctgca      1260
     gagcaggcaa cggagcccgg gtcggacgag accgtccgga ccacccctca ggcagagacc      1320
     ctggtcgaga ggcggctcac accggtcgca gccggcgccg ccgcaccagt ggagaaagct      1380
     ccgacggcag cggtcgaacc gcccaggtcc actgccgcca ccgagtcacc gttgctctcg      1440
     agccgggccc ggcgactggt cgcagccacg tccgctctcg gtggcctgct catcctcgcc      1500
     agcttcaccg ccccgtgggt gtacggcggc gtggccgagg cccagttccc cggacccacg      1560
     gcgggactct tcatcgtcgc cgtggcagcg accgttgtgg ccatcgcggt catcgtcgac      1620
     caaccgcgcg gcctggtcgc gacgggactc ggcctcggcg tggccctggt ggccgcgacc      1680
     agcctgctca cccccttcgg gatgctcgcc acggacgcca cgtcgatgcc caccggactc      1740
     ctgctcggcg tggccggcga gctgctcgtc gtgacagccg ggatcgtcac gctggcgtcg      1800
     ctgttgggct ccggacaagt ctccggagcc tgggctgggc tgccagaccg gcgcggactg      1860
     gtcggcttgg ggatcgtgtt ggtcggttca gtgaccttga tgctctatgc cggctggttg      1920
     tcggaccggc cgggcagcac gtggggggcg atcatgatcg tctgggccgt cacgtggctc      1980
     gccgccggcg ccgtggccac gagcaccaga cccgccgcct tggcccgcgc cttcctcgcc      2040
     ggctgggcga tcaccgctct gagccaaccg gtgtccgaca tgcagtacca gtacaacggc      2100
     gaaaccttcc cggctcagcc ggtggttctc cttgccctgc tcggactcgt ggtctgggcg      2160
     gcggtcccct ctcgtgagcg gccggccgtc agccaccgag aatga                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page