(data stored in ACNUC7421 zone)

EMBL: CP002343.PE54

CP002343.PE54        Location/Qualifiers
FT   CDS_pept        complement(62110..62502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1504 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46616"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL5"
FT                   /protein_id="ADU46616.1"
FT                   /translation="MNASLRLSLDEVGADRARLEVLHRQLRDELWHADALEVALLPAES
FT                   GAAPDGTRALGPAEIGALTVAVLGSGGLPTLLASLRGWLRRGAPSERSVRLEIDGDVIV
FT                   LEDADDLERHQLLQVFLDRHGIQGSA"
     gtgaacgcga gtctgaggct gtcattggac gaggtcgggg ctgaccgcgc acgtctcgag        60
     gtcctgcacc gccagcttcg ggacgagctg tggcacgctg acgcgctcga ggtcgccctc       120
     cttccggcgg agtccggtgc cgcgccggac gggacgcgcg cccttggccc ggccgagatc       180
     ggcgccctga ccgtcgccgt cctcggctcc ggcgggctgc ccacgctcct cgcctcgctg       240
     cgaggctggc tccgccgcgg agccccgtcc gagcgctcgg tccgcctcga gatcgacggc       300
     gacgtcatcg tgctcgagga cgccgatgac ctcgagcggc atcagctgct gcaggtcttc       360
     ctcgaccggc acgggatcca ggggtcggca tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page