(data stored in SCRATCH zone)

EMBL: CP002343.PE55

CP002343.PE55        Location/Qualifiers
FT   CDS_pept        complement(62924..63904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0055"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: bcv:Bcav_0018
FT                   mucin-associated surface protein (MASP); SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46617"
FT                   /db_xref="GOA:E6SEL6"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL6"
FT                   /protein_id="ADU46617.1"
FT                   /translation="MFRTKPTRSERLKMQVVEAREHAAATASELGHTAGERLAVMREQA
FT                   APVATDAAERVKLALDEAKLRAAPVAADLAERARPKVESAQSTLVDSLLPKVGAAIGVA
FT                   SAALAQGADEAKERMRDEPRVRHVRESARDHSDRVRDAYRVLSGEAVAKPVRHGRRTWL
FT                   IVIGLGAAAVAAVAAYRRQQADDPWATSSDGSLGGTGASTAFDASPSLKDKAAEKVGTA
FT                   KEAVTEAVTGAAAKAKDKATDLAAKGQAALADAKDRSSDDLVTDAEVEQASTWADEQLD
FT                   EPGATPWGNEGEVTAVDSTLGSDAIDGSVGTLPSETRGSTPKPKA"
     atgttccgaa cgaaaccgac ccgatccgag aggctcaaga tgcaggtcgt cgaggctcgg        60
     gagcacgctg cggccacggc cagcgagctc ggccacacgg cgggcgagcg gctcgccgtg       120
     atgcgcgaac aggcggcgcc ggtcgcgacc gacgctgctg agcgcgtcaa gctggccctc       180
     gacgaggcga agctgcgcgc ggccccggtc gccgcggacc tcgcagagcg ggcccggccg       240
     aaggtcgagt ccgcccagtc gacgttggtc gactcgctcc tgcccaaggt gggagcggcg       300
     atcggggtgg cttcggccgc cctcgcccag ggcgccgacg aggccaagga gcggatgcgc       360
     gacgaacccc gtgtgaggca tgtacgggag tcggcgcggg accacagtga ccgcgtgcgt       420
     gacgcctatc gcgtcctgag cggcgaggcc gtcgccaaac cggtccggca cggccggcgc       480
     acctggctca tcgtcatcgg tctcggtgcc gccgccgtcg cagccgtcgc tgcgtatcgc       540
     cggcagcagg ccgacgaccc gtgggccacc tcctcggacg ggagcctggg cgggaccggc       600
     gcctcgaccg ccttcgacgc gagcccctcg ctcaaggaca aggccgccga gaaggtgggc       660
     accgccaagg aggccgtcac cgaggcagtc accggggccg ccgccaaggc caaggacaag       720
     gcgaccgacc tggccgccaa gggtcaggcc gctctggcgg acgccaagga ccgctcctcc       780
     gacgacctcg tgacggacgc ggaggtggag caggcctcga cgtgggccga cgagcagctc       840
     gacgagcccg gagccacgcc gtggggcaac gagggcgagg tcaccgcggt ggactcgacg       900
     ctcggctccg acgccatcga cggctcggtc ggcaccctgc cgagcgagac gcggggcagc       960
     acgccgaaac ccaaggcctg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page