(data stored in ACNUC7421 zone)

EMBL: CP002343.PE56

CP002343.PE56        Location/Qualifiers
FT   CDS_pept        complement(64023..64613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1730 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46618"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL7"
FT                   /protein_id="ADU46618.1"
FT                   /translation="MSFIDKLKQKADELGLKEKADHLAEEAKKVAEQAREKAGDLAAEN
FT                   RDKVGSVLDKAGAKLDEKTEGKYADKIAKAKEQVAKGVDKLAEGGTHGSGGAPASGAGA
FT                   AAAGAAAGAGAAAAGGAAATPDDFDIIPDEEEVAEEVLSVEVDPEAPLDGPPEPDVSLG
FT                   AGRPERAYDETGEPIDDLPLEPDAPDVPGSGRW"
     atgtcattca tcgacaagct caagcagaag gcggatgagc tcggtctcaa ggagaaggcg        60
     gaccatctcg ccgaggaggc gaagaaggtg gccgagcagg cccgggagaa ggccggggac       120
     ctcgcggcgg agaaccggga caaggtcggg tcggtgctcg acaaggcggg cgccaagctg       180
     gacgagaaga ccgagggcaa gtacgccgac aagatcgcca aggcgaagga gcaggtcgcc       240
     aagggtgtcg acaagctggc cgagggcggc acgcacggct cgggaggcgc ccctgccagt       300
     ggggcgggag cagctgcggc cggcgctgcc gccggcgcgg gtgcggcagc ggccggtggg       360
     gccgcggcca cgccggacga cttcgacatc atcccggacg aggaggaggt cgccgaggag       420
     gtcctgtcgg tcgaggtcga cccggaggcc ccgctcgacg gaccacccga gccggacgtc       480
     agcctcggcg cagggcggcc cgaacgcgcc tacgacgaga cgggcgagcc gatcgacgac       540
     ctgccgctcg agcctgacgc cccggacgtc ccgggctccg gacgttggtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page