(data stored in ACNUC7421 zone)

EMBL: CP002343.PE58

CP002343.PE58        Location/Qualifiers
FT   CDS_pept        65326..66270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: xce:Xcel_0012 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: Rhomboid family protein; PFAM:
FT                   Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46620"
FT                   /db_xref="GOA:E6SEL9"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL9"
FT                   /protein_id="ADU46620.1"
FT                   /translation="MSDSGTGAQPPIAPGAGQQPAGPSVCPRHPDREAYVKCQRCGRPA
FT                   CPECQRPAAVGIQCVDCVREAARTAPTTRTVFGGRPTDGRPIVTQAIIGICVVVFLVQW
FT                   VSPGTTVDYAFAPSAGWIEPWRFVTAMFLHAPRSLLHIGFNLYALFILGSYLEPLMGRA
FT                   RLAALYLISGIGGQVSVLLFAGNPTIEGLFNGTDAAWATPVVGASGAIFGLFGALIVLN
FT                   RHLGRSAAGMYGVLLINGVLGFVIPNISWQAHLGGFVTGLACAGAIVLFRRQRVRHLTW
FT                   LALSAVLALLVVISVGKYLTVPVEIRDLTAFRR"
     ttgtccgaca gtggaaccgg agcccagccc cccatcgccc cgggggctgg gcaacagccg        60
     gccgggccct cggtgtgccc ccgccacccc gaccgcgaag cctacgtcaa gtgccagcgc       120
     tgtggccggc ccgcgtgccc cgagtgccag cgccccgccg cggtcggcat ccagtgcgtc       180
     gactgcgtcc gggaggcggc ccgcacggcc ccgacgaccc ggacggtctt cggcggccgg       240
     ccgaccgacg gccgccccat cgtcacacag gcaatcatcg gcatctgcgt cgtcgtcttc       300
     ctcgtccagt gggtttcgcc tggcacgacg gtcgactacg ccttcgcgcc gagcgcaggc       360
     tggatcgagc cctggcgttt cgtgacggca atgttcctcc acgcgccccg ctcgctgctg       420
     cacatcggtt tcaacctgta cgcgctcttc atcctcggct cataccttga gccgctcatg       480
     ggacgggccc gactcgccgc tctgtacctc atcagcggta tcggcggcca ggtgagcgtc       540
     ctgctcttcg caggcaaccc aaccatcgag ggcctcttca acgggacgga tgcggcctgg       600
     gcgacgccgg tggtgggcgc gtctggcgcc atctttggcc tgtttggtgc cctcatcgtg       660
     ctcaaccggc acctgggccg ttcagccgca gggatgtacg gcgtgctgct catcaacggg       720
     gtgcttgggt tcgtcatccc gaacatctcg tggcaggcgc acctcggcgg cttcgtcacc       780
     gggctggcct gcgccggggc aatcgtcctg ttcaggcgcc agcgtgtgcg gcacctgacg       840
     tggttggccc tcagtgcggt gctcgcactg ctcgtcgtga tctccgtggg caagtacctc       900
     acggtcccgg tcgagatccg cgatctcacc gcgttccgcc gctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page