(data stored in ACNUC7421 zone)

EMBL: CP002343.PE6

CP002343.PE6         Location/Qualifiers
FT   CDS_pept        7081..8604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0006"
FT                   /product="peptidase M4 thermolysin"
FT                   /note="COGs: COG3227 Zinc metalloprotease (elastase);
FT                   InterPro IPR013856: IPR001570; KEGG: cms:CMS_1343 putative
FT                   metalloprotease; PFAM: peptidase M4 thermolysin; Peptidase
FT                   M4 thermolysin; SPTR: Metalloprotease; PFAM: Thermolysin
FT                   metallopeptidase, alpha-helical domain; Thermolysin
FT                   metallopeptidase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46568"
FT                   /db_xref="GOA:E6SDW5"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW5"
FT                   /protein_id="ADU46568.1"
FT                   /translation="MHPATESPEPLASEARCSIVPPYILEALARSSEPAVADAARTSLA
FT                   HDEAIRRARRSGRRLAPPRDVNEPGPPAPSGPQAPTDPTQPTEPTEPSPPLGTGPRRTI
FT                   GDAQGKRTLPGETVRPEGDPATGDPAVDEAYDGLGATWGLWSAAYGRDSLDDKGMPLIA
FT                   TVHYGQRYDNAFWDGRQMVFGDGDGIVFDRFTKSLDVIGHELAHGVTEHTAGLLYQGQP
FT                   GALNESVSDVFGVLVKQRALGQTASEADWLVGAELLLPSVQGRALRDMRKPGTAYDDPE
FT                   LGKDPQPAHMDGYVVTDSDFGGVHINSGIPNRAFVLAALAMGGHAWEEAGAIWHAALTG
FT                   DGIRADCDFARFAELTVAAAAERHGYGSVQHSAVRDAWLEVGVPVGSDEPASSAEADEA
FT                   AGPPSGPAHGEVPGVDAEVLVRRTGGFAGRVRERTVTIGDLPERDARDWQHLLAAPTLQ
FT                   RIAATAGRSHPDAFCYDVVCPQAHVDVTVAEPHLPEAIHQLLERTLEDG"
     atgcaccccg cgacggagtc acccgaaccc ctggcgtccg aggcccgctg ctcgatcgtc        60
     ccgccctaca tcctcgaggc cctggctcgc agctccgagc cggcggtcgc cgatgcggct       120
     cggacctcac tcgcccacga cgaggcgatc cgccgggccc ggcgctctgg gcgccgcctc       180
     gccccacccc gcgacgtcaa cgagccggga ccaccggcgc cctccggtcc gcaggccccc       240
     accgatccca cccagcccac tgagccaacg gagccgagcc caccgctcgg cacgggcccg       300
     aggcgcacca tcggcgacgc gcagggcaag cgcaccctcc ccggcgagac ggtgcgcccc       360
     gagggggacc cggccaccgg cgatcccgcc gtggacgagg cctacgacgg actgggcgcg       420
     acctggggac tgtggtcagc ggcatacggc agggactccc tcgacgacaa ggggatgccg       480
     ctcatcgcca cggtgcacta cggccagcgc tacgacaacg cgttctggga cgggcgccag       540
     atggtgttcg gcgacggcga cgggatcgtc ttcgaccggt tcaccaagag cctcgacgtc       600
     atcgggcacg agctcgcgca cggggtcacc gagcacaccg cgggccttct ctaccagggc       660
     cagccgggcg ccctcaacga gtcggtctcc gacgtcttcg gtgtgctcgt caagcagcgt       720
     gccctcggcc agacggcgtc ggaggccgac tggctcgtcg gggccgagct gctgttgccg       780
     tccgtgcagg ggcgggcgct gcgcgacatg cgcaagccgg gtacggccta cgacgacccc       840
     gagctgggca aggacccaca gccggcccac atggacggct acgtcgtcac cgacagcgac       900
     ttcggcgggg tgcacatcaa ctcggggatc cccaaccggg ccttcgtcct cgcggccctg       960
     gcgatgggcg gccacgcctg ggaggaggcg ggtgcgatct ggcacgcggc gttgaccggt      1020
     gacgggatcc gcgcggactg cgacttcgcg cggttcgcgg aactgaccgt cgcggcggcc      1080
     gccgaacggc acggctacgg gtcggtgcag cactccgccg tgcgcgacgc ctggctcgag      1140
     gtcggtgtcc cggtcggcag tgacgagccc gcctcgtcag ctgaggccga cgaggcggcc      1200
     gggccgccga gcgggcccgc gcacggggag gtccccgggg tcgatgccga ggtcctcgtg      1260
     cgtcggaccg gcgggttcgc gggccgggtg cgggagcgca cggtgacgat cggtgatctg      1320
     ccggagcgtg acgcgcgaga ctggcagcac ctcctcgctg cgccgacgct ccagcggatc      1380
     gctgcgaccg cagggcggag ccaccccgat gcgttctgct acgacgtcgt ctgcccgcag      1440
     gcccacgtcg atgtcaccgt cgccgagcca cacctgcccg aggcgatcca ccagctgctc      1500
     gagcgcacgc tcgaggacgg ctga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page