(data stored in SCRATCH zone)

EMBL: CP002343.PE62

CP002343.PE62        Location/Qualifiers
FT   CDS_pept        complement(68219..70105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0062"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR017442: IPR005543: IPR020635: IPR002290: IPR
FT                   017441: IPR008271: IPR000719; KEGG: kra:Krad_0072 protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine-protein kinase, catalytic domain;
FT                   PASTA domain containing protein; SPTR: Tyrosine protein
FT                   kinase:Serine/threonine protein kinase:PASTA; PFAM: Protein
FT                   kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46624"
FT                   /db_xref="GOA:E6SEM3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM3"
FT                   /protein_id="ADU46624.1"
FT                   /translation="MTTTPRVLGGRYEVGQLIGRGGMADVHLGHDTRLGRQVAIKMLRS
FT                   DLARDANFLKRFRREAQSAAGLNHPSIVAIFDSGEDESWVEGPNGTLTTVPYMVMEYVD
FT                   GKTLRQQLTVHQKLAPAEAIRITEGILDALAYSHRMGIVHRDIKPANVMITETGHIKVM
FT                   DFGIARAIADSAATMTQTQSVVGTAQYLSPEQAQGQTVDARSDLYSTGCLLFELLTGRP
FT                   PFQGDSPVAIAYQHVGETPQPPSVYNAAVGGDLDAVTLHALVKDRTQRYQDADSFRADL
FT                   ENVRLGQPISAAARGALAAGAAGAASAAATQTMPAAGAAGAAATVVQPPVITSRRQRYE
FT                   NTAGMPAVGHDEVEERQQRGGAGRAALVTLLVLAVLGLIGWGAATWFGNQEPPVAMTTV
FT                   PNLRGLDEPAVERALAQRGLQGNRSEDSNEMEPGKVFEQSPAAGEAVQEGTVVRYTVST
FT                   GPASITIPDVRNFDRGDAEKALADAGLTNVGVETKDDPDTAKDKVIETNPPIGTQVGRD
FT                   TTVTLVVGSGKTVVPDDQVGRDWSLASNALAKAGLNPKRVDVESDKTPGTVLSVAKEGE
FT                   KVDIGTEIKVEVATSPAPKPTTETVTTTVIQTPSGTETSTTTSEPPADGGAG"
     gtgacgacca caccgcgcgt cctcggcgga cggtacgagg tcggccagct catcggccgc        60
     ggcggcatgg ccgacgtcca cctcggccac gacacccggc tgggccggca ggtcgcgatc       120
     aagatgctgc gatcggacct ggcccgcgac gcgaactttc tcaagcggtt ccggcgtgag       180
     gcccagtcgg cagccgggct caaccatccc tcgatcgtcg ccatcttcga ctccggcgag       240
     gacgagtcgt gggtcgaggg gcccaacggc accctcacca cggtgcccta catggtgatg       300
     gagtacgtcg acgggaagac cctgcggcag cagctgaccg tccaccagaa gctcgcaccg       360
     gccgaggcga tccggatcac cgagggcatt ctcgacgcct tggcctacag ccaccggatg       420
     ggcatcgtcc accgcgacat caaaccggcc aacgtgatga tcaccgagac cggccacatc       480
     aaggtgatgg acttcggcat cgcccgcgcg atcgcggaca gcgccgcgac catgacgcag       540
     acgcagtccg tggtgggcac ggcgcagtac ctctcgccgg agcaggccca gggccagacg       600
     gtcgacgcgc gcagcgacct ctactcgacc gggtgcctgc tcttcgagct gctgaccggt       660
     cggcccccct tccagggcga ctcgcccgtc gcgatcgcct accagcacgt cggtgagact       720
     ccccagccgc cgagcgtgta caacgccgcc gtcgggggcg acctcgacgc ggtgacgctc       780
     cacgccctgg tcaaggaccg cacccagcgc taccaggacg cggactcctt ccgcgcggat       840
     ctcgagaacg tccggctcgg tcagccgatc agcgcggccg cccgcggcgc cctcgcggcc       900
     ggcgcggccg gcgcggcgag tgcagcggcg acgcagacga tgcctgcagc gggcgctgcg       960
     ggagcggcgg cgaccgtcgt gcagccaccc gtcatcacct cccgccgcca gcgctacgag      1020
     aacacggcgg gaatgccggc cgtcggacac gacgaggtcg aggagcgtca gcagcgcggc      1080
     ggcgcgggcc gcgccgctct ggtcaccctg ctggtgctcg cggtcctcgg cctcatcggc      1140
     tggggggcgg caacctggtt cggcaaccag gagcccccgg tcgcgatgac gaccgtgccc      1200
     aacctccgag gtctggacga gcccgctgtc gagcgggccc tggcgcagcg cggcttgcag      1260
     gggaaccgga gcgaggactc caacgagatg gagcccggga aggtcttcga gcagagtccg      1320
     gctgccgggg aagcggtcca ggaggggacg gtggtgcgct acacggtgtc gaccggtccg      1380
     gcgagcatca ccatccccga cgtgcgcaac ttcgaccggg gagacgccga gaaggccctc      1440
     gccgacgccg gcctcaccaa cgtcggggtc gagacgaagg acgatcccga caccgccaag      1500
     gacaaggtca tcgagaccaa tccgccgatc gggacccagg tcggcaggga cacgacggtg      1560
     accctcgtcg tcggaagcgg caagaccgtc gtccccgatg accaggtggg ccgcgactgg      1620
     tccctggcgt ccaacgcgct cgccaaggcc gggctcaacc cgaagcgggt cgacgtggag      1680
     tcggacaaga ctcccggcac ggtcctgtcc gtggccaagg agggggagaa ggtcgacatc      1740
     ggcaccgaga tcaaggtgga ggtggccacc tcaccggctc cgaaacccac cacggagacg      1800
     gtgacgacga ccgtgatcca gacgccgagc gggaccgaga cgagcacgac gaccagcgag      1860
     ccacccgctg acggcggagc aggctga                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page