(data stored in ACNUC7421 zone)

EMBL: CP002343.PE64

CP002343.PE64        Location/Qualifiers
FT   CDS_pept        complement(71441..72904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0064"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460;
FT                   KEGG: kse:Ksed_00200 cell division protein
FT                   FtsI/penicillin-binding protein 2; PFAM: penicillin-binding
FT                   protein transpeptidase; PRIAM: Peptidoglycan
FT                   glycosyltransferase; SPTR: PbpA; PFAM: Penicillin binding
FT                   protein transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46626"
FT                   /db_xref="GOA:E6SEM5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM5"
FT                   /protein_id="ADU46626.1"
FT                   /translation="MNTAIRRLSVLIAALFGALLVASTVIQFVQAGSMRGMAANKRTLL
FT                   DNYAQERGSILVAGQPIAKSVEVDDQYRWLRTYPDGRLYSQITGFYAYSVGNPFGLEDA
FT                   ADDLLSGKADRLFVRRVTDLLTGRETAGATIELTIDPKVQQAASDALGKNRGAVVALDP
FT                   RTGAILAMVSHPQYDPNPLSSHDLDKAASAWKKLSTDRSKPFTNRAISGDLYPPGSTFK
FT                   VVTAAAALEQGIVDDESSMVPGPAALDLPLTDQPLPNETRQPCGPDDRTTLLHALEISC
FT                   NTAFGSLGLELGGEQLRAQAAKFGFGDSIQIPMRVSPSTMPAEMNQPQAAQSAIGQYEV
FT                   RTTPLQMAMIAAGIANQGRVMTPYLIQSVRTADLDVIDGPPDPKELSQAVSTRTADILK
FT                   RMMVSVVDNGSGRRAQIPGVAVGGKTGTAQHDLEKSPHAWFISFAPADDARVAVAVIVE
FT                   ESGVSGNEVGGAAVAAPIAKAVMEAVIGR"
     gtgaacaccg cgatccgccg gctctccgtc ctcatcgccg ccctcttcgg cgcgctgctc        60
     gtcgcctcga cggtcatcca gttcgtgcag gccgggtcca tgcgcggcat ggccgccaac       120
     aagcgcacgc tcctcgacaa ctatgcgcag gagcgcggct ccatcctcgt cgcgggacag       180
     cccatcgcca agtccgtcga ggtcgacgac cagtaccgct ggctccgcac ctaccccgac       240
     ggccggctct actcgcagat caccggtttc tacgcctact ccgtcggcaa ccccttcggc       300
     ctcgaggacg ccgcggacga cctcctctcc ggcaaggcgg accgcctctt cgtccgccgg       360
     gtcaccgacc tgctcaccgg gcgcgagacg gccggcgcca cgatcgagct gaccatcgac       420
     cccaaggtcc agcaggcggc ctccgacgcc ctcggcaaga accggggcgc ggtggtcgcc       480
     ctcgacccga ggaccggcgc gatcctcgcg atggtgagcc acccgcagta cgaccccaac       540
     ccgctgtcga gccatgacct ggacaaagcc gcctcggcgt ggaagaagct ctcgacggac       600
     cggtccaagc cgttcaccaa ccgggccatc agtggtgacc tctatccgcc ggggtcgacg       660
     ttcaaggtcg tcaccgccgc ggcggcgctg gagcagggca tcgtcgacga cgagagctcc       720
     atggttcccg gccccgccgc gctggacctg ccgctcacgg accagccgct gcccaacgag       780
     acccgtcagc cctgcggccc cgatgaccgc accaccctgc tccatgcgct cgagatctcg       840
     tgcaacaccg ccttcggctc actcggcctc gagctcggcg gcgagcagct gcgcgcccag       900
     gccgccaagt tcggcttcgg cgactcgatc cagatcccga tgcgggtctc gccgagcacg       960
     atgccggcgg agatgaacca gccccaggcg gcccagtcgg cgatcggcca gtacgaggtc      1020
     cgcacgacac cgctccagat ggcgatgatc gcggcaggga tcgccaacca gggccgggtg      1080
     atgaccccct acctgatcca gtcggtccgc accgccgacc tcgacgtcat cgacggcccg      1140
     cccgacccga aggagctgtc gcaggcggtc tcgacgcgca cggccgacat cctcaagcgg      1200
     atgatggtct ccgtggtgga caacggcagc ggccgccgcg cgcagatccc cggggtcgcc      1260
     gtcggaggca agaccggcac cgcgcagcac gacctcgaga agagcccgca cgcctggttc      1320
     atcagcttcg cccccgcgga cgacgcgcgg gtggccgtgg ccgtcatcgt cgaggagagc      1380
     ggggtcagcg gcaacgaggt gggtggcgcc gcggtcgcgg cccccatcgc caaggccgtc      1440
     atggaggcgg tgatcggccg atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page