(data stored in ACNUC7421 zone)

EMBL: CP002343.PE65

CP002343.PE65        Location/Qualifiers
FT   CDS_pept        complement(72901..74292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0065"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: kra:Krad_0074 cell cycle
FT                   protein; PFAM: cell cycle protein; SPTR: Putative
FT                   FtsW/RodA/SpoVE family cell cycle protein; PFAM: Cell cycle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46627"
FT                   /db_xref="GOA:E6SEM6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM6"
FT                   /protein_id="ADU46627.1"
FT                   /translation="MTTTVEPVTPRTRRGVELVLLIVAIAVVLLAWVTVDLNRNGTVPA
FT                   EIIPVAGGLVVLAGVVHVVLRWKAPYADPVLLPITTALNGLGLVMIHRLDLAAGRLGAD
FT                   GNANQQIIWTALAVALTVAAIWTLRDHRLLRRYTFISLAVGFILLTLPLVPGLGREVNG
FT                   SRIWIAVGPFSFQPGEFAKIALAVFFAGYLVQTRDVLSLAGKRVLGFTFPRGRDLGPIL
FT                   VAWVLALLILVFEKDLGSALLFFGLFVAMLYVATERVSWIAIGLLLFGAAVAFALSAFA
FT                   HFQKRVDLWLDPFSTENLERSNQLANGLWGMAAGGLTGTGLGAGRPWLTPFAESDYIFA
FT                   SLAEELGLIGAVGILMLYLLFVERGVRTALGVRDGFGKLLAIGLTFSVAFQLFIVIGGV
FT                   TRLIPLTGLTTPFLSLGGSSLLANWIIMSLLLRISDQARRPVPALPIGVGADPATAEAT
FT                   QVVRL"
     atgacgacca ccgtcgagcc ggtcaccccg agaacgcgcc gaggcgtcga gctggtcctg        60
     ctcatcgtgg cgatcgccgt cgtgctgctg gcctgggtga ccgtcgacct caaccgcaac       120
     ggcacggtcc ccgccgagat catcccggtc gccggcggcc tcgtcgtcct cgcgggggtc       180
     gtccacgtgg tgctgcgctg gaaggcgccc tacgccgacc cggtcctgct cccgatcacc       240
     acggcgctca acggcctcgg cctcgtcatg atccaccgac tcgacctcgc cgcgggccgg       300
     ctcggcgccg acggcaacgc caaccagcag atcatctgga ccgccctcgc ggtcgcgctg       360
     accgtcgccg cgatctggac gctgcgggac caccggctcc tgcgtcgcta cacgttcatc       420
     tcgctcgcgg tggggttcat cctgctcacc ctgccgctcg tgccggggct ggggcgcgag       480
     gtcaacggct cccggatctg gatcgccgtc gggccgttca gcttccagcc gggcgagttc       540
     gccaagatcg ccctggccgt cttcttcgcc ggctacctcg tccagacccg tgacgtcctc       600
     agcctggcgg gcaagcgcgt gctgggcttc accttccccc gcgggcgcga cctgggcccg       660
     atcctcgtcg cctgggttct cgcgctgctc atcctcgtct tcgagaagga cctcgggtcg       720
     gcgctcctct tcttcgggct cttcgtggcg atgctctacg tcgccacgga gcgggtctcg       780
     tggatcgcca tcggcctgct cctcttcggg gctgccgtcg cgttcgccct gtcggccttc       840
     gcgcacttcc agaagcgggt cgacctgtgg ctcgacccgt tctccacgga gaacctcgag       900
     cgttccaacc agcttgccaa cgggctgtgg gggatggctg ccggtggtct caccggcacc       960
     ggcctggggg ccggtcggcc gtggctcacc cccttcgccg agagtgacta catcttcgcc      1020
     agtctcgccg aggagctggg gctcatcggg gcggtcggaa tcctcatgct gtacctgctc      1080
     ttcgtcgagc ggggcgttcg gacggccctc ggtgtgcgtg acgggttcgg gaagctgctc      1140
     gccatcgggc tgaccttctc ggtcgcgttc cagctcttca tcgtcatcgg cggcgtgacc      1200
     cggctcatcc cgttgaccgg gctcacgacg cccttcctct ccctgggggg atcctcgctg      1260
     ctcgccaact ggatcatcat gtcgctcctg ctgcggatct ccgaccaggc ccgccgcccc      1320
     gtcccggcac tgccgatcgg ggtcggcgcc gaccccgcga ccgcggaggc gacgcaggtg      1380
     gtgcgcctgt ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page