(data stored in ACNUC7421 zone)

EMBL: CP002343.PE66

CP002343.PE66        Location/Qualifiers
FT   CDS_pept        complement(74289..75752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0066"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kra:Krad_0075 protein
FT                   phosphatase 2C-like; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein; SPTR:
FT                   Putative magnesium or manganese-dependent protein
FT                   phosphatase; PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46628"
FT                   /db_xref="GOA:E6SEM7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM7"
FT                   /protein_id="ADU46628.1"
FT                   /translation="MAIALRYAARSDLGLGPKSRNEDSGYAGPNLLVLADGMGGHAAGD
FT                   VASSMIVGELAPLDDEDIGADQAIPLLERSLRSANARLTRAMRENSDLAGMGSTTIVML
FT                   RTGNKIAMAHIGDSRAFMLRGDSFSQITKDHSFVQQLVDEGRISKEEAGSHPQRSVVTR
FT                   VMTGQPDDDPDTSLREAKVGDRFLLCSDGLSDFVGADVIEEILAGAASPEEAADRCVEV
FT                   ALKAHTRDNVTVIVADVVDPDGDDLPTTVPQVVGAAARSLRDKTKAIPTTPAEKAAALS
FT                   REALGQKERVDPAPELAESTRRSRRSRGLRRALATLVVLGILVGGGYAAWAWSQQQFYV
FT                   GADAGQVAIFRGVDGEIGPIDLSGIEVRSDVVVTELPSDVQAAVSRTIPAADLADARAK
FT                   VDRLRAEALRCRGLATTGIPCGDTPVTTPTPTPTTPTSPSTPPSTAPIPTSSTTSTTPT
FT                   TAPAPNAAPTPGPSQPARAALGSSTEVVG"
     atggccatcg ccctgcgcta cgccgcgcgc tccgacctgg gtctggggcc gaagtcccgc        60
     aacgaggact ccggctacgc cgggcccaac ctcctcgtcc tcgccgacgg gatgggcggc       120
     cacgccgcag gtgacgtggc gagctcgatg atcgtcgggg agctggcgcc cctcgacgac       180
     gaggacatcg gggcggacca ggcgatcccg ctgctcgagc gctccctgcg gtccgccaac       240
     gccaggctga ctcgggcgat gcgcgagaac tccgacctcg cgggcatggg gtcgaccacc       300
     atcgtcatgc tgcgcaccgg caacaagatc gccatggcgc acatcggcga ctcgcgggcg       360
     ttcatgctcc gcggtgacag cttcagccag atcaccaagg accactcgtt cgtccagcag       420
     ctcgtcgacg agggccggat ctccaaggag gaggcgggca gccaccccca gcggtcggtg       480
     gtgacccgcg tcatgaccgg ccagcccgac gacgacccgg acacctcgct gcgcgaggcc       540
     aaggtcggcg accgcttcct gctctgctcg gacggcctgt ccgacttcgt cggggccgac       600
     gtcatcgagg agatcctcgc cggcgctgcg tcgccggagg aggccgcgga ccgctgcgtc       660
     gaggtggccc tcaaggccca cacccgcgac aacgtcaccg tcatcgtcgc cgatgtcgtc       720
     gacccggacg gtgacgacct gcccaccacg gtcccccagg tcgtcggagc cgcggcacgc       780
     agccttcggg acaagaccaa ggcgattccg acgacgcctg cggagaaggc agccgccctc       840
     tcccgcgagg ccctcggtca gaaggaacgg gtggacccgg cgccggagct ggccgagagc       900
     acgcgccggt cccgccggtc caggggcctg cgccgcgcgc tcgcgaccct ggtcgtgctc       960
     ggcatcctcg tcggcggcgg ctacgcggcg tgggcctggt cccaacagca gttctacgtc      1020
     ggcgccgacg ccgggcaggt cgcgatcttc cgcggggtcg acggcgagat cggcccgatc      1080
     gacctctccg gcatcgaggt tcgcagcgac gtggtcgtga ccgagctgcc gtccgacgtc      1140
     caggcggcgg tgtcccggac catcccggcc gccgacctcg ccgacgcccg ggccaaggtc      1200
     gaccggctcc gcgccgaggc gctgcgctgc cgcggcctcg ccaccaccgg gatcccgtgc      1260
     ggagacaccc cggtgacgac gccgaccccc accccgacca cgccgaccag cccgagcacc      1320
     ccaccgagca ccgcaccgat cccgacgtcg tccacgacct cgacgacacc gaccaccgcg      1380
     ccggccccga atgcagcccc gacaccgggc ccgagccagc ccgcccgcgc cgcgctgggg      1440
     tcgtcgaccg aggtggtcgg atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page