(data stored in ACNUC7421 zone)

EMBL: CP002343.PE67

CP002343.PE67        Location/Qualifiers
FT   CDS_pept        complement(75756..76319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0067"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro IPR000253;
FT                   KEGG: sco:SCO3844 secreted protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein; SPTR: Putative membrane protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46629"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM8"
FT                   /protein_id="ADU46629.1"
FT                   /translation="MSELTLTLLRLGLLALLWIFVFSVVGVLRTDIYGTSVSRRSQRKA
FT                   LREQERQQQRAAKEARRAPAPAPLAGPDPTPQRARFGRGRSRGAPTKVVVTEGPLAGTS
FT                   LPLRGQAILIGRNPECALVLDDDYASGRHCRIFQDPATVGGWVVEDLGSTNGTFIGRDK
FT                   LTSPQPVEVGTTLRIGTTLLEFRD"
     atgagcgaac tgaccctcac cctgctgcgg ctggggctgc ttgcgctgct gtggatcttc        60
     gtcttcagcg tggtcggagt gctccgcacc gacatctacg ggacgagcgt ctcgcgccgt       120
     tcgcagcgca aggccctgcg cgagcaggag cgtcagcagc agcgggcggc gaaggaggcc       180
     cggcgcgccc cggcgcccgc cccgctggcc gggcctgacc cgacgccgca gcgggcccgc       240
     ttcggccggg gtcgctcgag gggtgcaccc accaaggtcg tcgtgaccga gggccccctg       300
     gcggggacct cgctcccgtt gcgtggccag gccatcctca tcggacgcaa ccccgagtgc       360
     gccctcgtcc tcgacgacga ctacgcgtcc gggcggcact gccgcatctt ccaggacccg       420
     gcgaccgtcg gcgggtgggt ggtcgaggac ctcgggtcca ccaacggcac gttcatcggc       480
     cgggacaagc tgacgtcgcc ccagccggtc gaggtgggca cgacgttgcg catcggcacg       540
     acactcctcg agttccggga ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page