(data stored in SCRATCH zone)

EMBL: CP002343.PE69

CP002343.PE69        Location/Qualifiers
FT   CDS_pept        77359..78924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0069"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: bfa:Bfae_03240 chromosome partitioning
FT                   ATPase; SPTR: ATPase involved in chromosome partitioning;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN0"
FT                   /protein_id="ADU46631.1"
FT                   /translation="MSNDDSGGAKGQGIPGYSANNTIPGGFSLPLPTATNSAADAVAEA
FT                   PEPADPWSSTWDDTSWQLPEPDSSVSLYSRDELSQYAGTDHGDRSDWADSYDHGGDQAG
FT                   APRTGALSGWDAWEPSGASGFNPDTGHWSDLQHNDETAARSAEEYSGWTPAGSPAPAPL
FT                   NGLHHPGVHVAAVQAHAATPPIDPDVAAAAVELGHDPGSAAYGPEPLVHVDHERPNADD
FT                   LITVRSKGERQKVKASSGLRRAFGLGPGLRELLERDRIDRIARPLSGRKTIMVINTKGG
FT                   GGKTLVTLMLASYLGRYRSGSVLAWDNNETEGTLGMRAPSQSHHRTVVDLLGALPSIAA
FT                   DPNAGTSELEHWVREQRGLSFDVLASADDDEAMRVIGEQEFEDLHTQLSRFYRMIVVDT
FT                   GNNRLSPNWLAAAARADMLVFATSLKDDTSVVAAKNLDALVAMGRGDLVKNAVCVISHT
FT                   TAKGNDVGAGVHTREHFEQWVRAVVDIPYDPALAPGLHLDPLKISRKTHESCMEMTATV
FT                   VDGL"
     atgagcaacg acgacagcgg cggcgccaag gggcagggca tccccggcta ctccgccaac        60
     aacaccattc ccggcgggtt ctccctccca ctccccacgg caacgaactc tgccgccgac       120
     gccgtcgccg aggcccccga gccggctgat ccctggtcct ccacctggga cgacacgtcc       180
     tggcagctgc ctgagcccga ctccagcgtc agcctctact cccgtgacga gctgagccag       240
     tacgccggca cggaccacgg cgaccggtcc gactgggccg actcctacga ccacggcggg       300
     gaccaggcgg gcgccccgag aaccggcgcg ctcagcgggt gggatgcgtg ggagccctca       360
     ggcgcgagcg ggttcaaccc cgacaccggc cactggtccg acctgcagca caacgacgag       420
     acggccgccc ggtcagcgga ggagtactcc ggttggaccc cggccggctc gcccgcaccg       480
     gcccccctca acggcctgca ccatccgggc gtgcacgtcg ccgccgtgca ggcgcacgcc       540
     gcgacgcccc cgatcgaccc ggacgtggcc gcagcggcag tggagctcgg gcacgatccg       600
     ggctcagcgg catacggccc ggaaccgttg gtgcacgtcg accacgagcg accgaacgcc       660
     gacgacctca tcacggtccg ctcgaagggg gagcggcaga aggtcaaggc gagctccggt       720
     ctgcgacgcg ccttcggcct cggaccgggg ctgagggagc tgctcgagcg cgaccgcatc       780
     gaccggatcg cccgacccct gtccggccgc aagacgatca tggtcatcaa caccaagggc       840
     ggcggcggca agaccctggt caccctcatg ctcgcgagct acctcggccg gtaccgctcc       900
     ggctccgtcc tggcctggga caacaacgag accgagggca cgctcggcat gcgagccccg       960
     tcgcagagcc accaccgcac cgtcgtcgac ctcctcggcg ccctgccgtc gatcgcggcc      1020
     gaccccaacg ccggcacgtc cgagctcgag cactgggtcc gggagcagcg cggcctgtcg      1080
     ttcgacgtcc tcgcctcggc agacgacgac gaggcgatgc gcgtcatcgg ggagcaggag      1140
     ttcgaggacc tgcacaccca gctgtcccgc ttctaccgga tgatcgtcgt cgacacgggc      1200
     aacaaccgac tgtccccgaa ctggctcgca gcagcggccc gcgccgacat gctcgtcttc      1260
     gcgacgtcac tcaaggacga cacctccgtc gtcgcggcga agaacctcga cgcgctcgtg      1320
     gcgatgggcc gcggcgacct cgtcaagaac gccgtctgcg tgatctcgca cacgacggcc      1380
     aagggcaacg acgtcggtgc cggcgtgcac acgcgtgagc acttcgagca gtgggtccgc      1440
     gcggtcgtcg acattccgta cgacccggcg ctcgcaccgg gcctccacct cgacccgctc      1500
     aagatcagcc ggaagaccca cgagtcgtgc atggagatga cggccaccgt cgtcgacggc      1560
     ctctga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page