(data stored in ACNUC7421 zone)

EMBL: CP002343.PE7

CP002343.PE7         Location/Qualifiers
FT   CDS_pept        complement(8714..10039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_09010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46569"
FT                   /db_xref="GOA:E6SDW6"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW6"
FT                   /protein_id="ADU46569.1"
FT                   /translation="MNTTDPRLKDLFAERSQRVHVVGDLAERAIARDRANRRREVTTAV
FT                   AVGAVALAVAVPVGWNATRPDSVRPVPAVSTSGGLTSTEPAPSPSQSTSQSTTTDQPTD
FT                   RPTSIPTITLSGAPAPATLAPSADPSGPAGDTAVAYVIDGELHDGLSRITLPDALARPA
FT                   QVARLADRLVLLVTDDGVTVVDASGAVLTDLPGGRAVAVSSDRTHFILTGDTGDLTYHD
FT                   ARGRQLAQLPAATCKCGSDGGAPSAYQAAVGLVGTTAYAAKGYTGTTVAWDVETGATKD
FT                   LPGQFRMVDSERAVAVVQIGGATGENPCYDLRDLATNARRWRVCGPVLMQSFSLDGQYV
FT                   VGTGAVDGLRSSVTYPTVLVWRTTDGELLLESGDPTGPGPWSVSARAATGQDIAVQVGH
FT                   EDGTRSLQRCTLEGRCEVIAPARPRWQSDIPEGDDPYILATN"
     atgaacacca cagacccccg gctcaaggat ctcttcgccg agcgcagcca gcgcgtgcac        60
     gtcgtcggcg acctggccga gcgggccatc gcccgcgacc gcgccaaccg gcgccgtgag       120
     gtgacgactg cggtcgccgt cggagcggtc gccctcgccg tggcggtccc cgtcggctgg       180
     aacgcgacgc gaccggacag cgtgcgcccc gtcccagcgg tgagcacctc cggaggcctc       240
     acgtcgaccg agccggcacc gagcccgagc cagagcacga gccagagcac gaccaccgac       300
     cagccgacgg accgcccgac ctccatcccc acgatcacgc tgagcggcgc accggcgccc       360
     gcgacgctgg cgccgtcggc cgaccccagc ggaccggccg gcgacaccgc agtcgcctac       420
     gtcatcgacg gggagctgca cgacggcctg tcgaggatca ccctgcccga cgcgctggct       480
     cgacccgccc aggtcgcccg cctcgccgac cggctggtgc tcctcgtcac cgacgacgga       540
     gtgaccgtgg tcgacgcctc gggcgcggtc ctcacggacc tcccgggagg acgcgccgtg       600
     gccgtgtcct ccgaccggac ccacttcatc ctgacggggg acacggggga cctgacgtac       660
     cacgacgccc ggggccgcca gctggcgcag ctccccgcgg cgacctgcaa gtgcgggtcc       720
     gacggtgggg ccccgagtgc ctaccaggcg gccgtcggac tcgtcggcac gaccgcctac       780
     gcggcgaagg gctacaccgg cacgacggtg gcctgggacg tggagaccgg tgccaccaag       840
     gacctgcccg gccagttccg gatggtcgac tccgagcggg cggtggccgt cgtccagatc       900
     ggtggagcca ccggcgagaa cccgtgctat gacctgcgtg acctggccac caacgccagg       960
     cggtggcggg tctgtgggcc ggtgctgatg cagtccttct ccctcgacgg ccagtacgtc      1020
     gtcggcaccg gcgcggtcga cgggctccgg tcctcggtga cctacccgac ggtcctcgtg      1080
     tggcgcacca cggacggcga gctgctcctc gagagcggcg acccgaccgg tcccggaccg      1140
     tggtcggtga gcgcccgcgc ggccaccggt caggacatcg ccgtccaggt ggggcacgag      1200
     gacgggacac gctcgctgca gcgctgcacc ctggaggggc ggtgtgaggt catcgctccg      1260
     gccaggccac ggtggcagtc cgacatcccc gagggggacg acccctacat cctcgccacc      1320
     aactga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page