(data stored in ACNUC7421 zone)

EMBL: CP002343.PE73

CP002343.PE73        Location/Qualifiers
FT   CDS_pept        82087..83142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0073"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843: IPR001761; KEGG: sro:Sros_7934 putative
FT                   LacI-family transcriptional regulator; PFAM: regulatory
FT                   protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   SPTR: Putative LacI-family transcriptional regulator;
FT                   manually curated; PFAM: Bacterial regulatory proteins, lacI
FT                   family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46635"
FT                   /db_xref="GOA:E6SEN4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN4"
FT                   /protein_id="ADU46635.1"
FT                   /translation="MTAESRDRTTSRPTMADIAAEAHVSVKTVSRVVNHEPGVRPDTAE
FT                   RVRGVIERIGFRRGDSGSTLRHGRTFTIGLVVEDLADPFYSQISAAVEREARIHRYLLV
FT                   TASAEGSPTRERSVLKGLVARRVDGLVVVPAGETPVADPTVISSRTPVVYLDRPVLSET
FT                   PVDTVLSDNLGGIRSAVEHLVAHGHRRIGFLGDSPDVWTARQRREGFITTLRDLRLPGT
FT                   PLVAMGPHTPETVRTALTRWTSGADPVTAVITGNTRVTIPALTSLHHWATQLSYVAYDD
FT                   FELSDVVEPAVTVVHQDPAAMGQKAAQQLFARLLGDEGPAQVVVLPTRLIVRASGVPRH
FT                   PGRDVRTVSAS"
     atgacagcgg agtcacgcga tcggacgacg agccggccga caatggccga catcgccgcc        60
     gaagcgcacg tctccgtcaa gacagtctcc cgcgtcgtca accacgagcc cggggttcgt       120
     ccggacaccg ccgaacgcgt ccggggcgtc atcgaacgga tcgggttccg gcgtggcgac       180
     agcgggtcga ccctgcgcca cggccgtacc ttcacgatcg ggctcgtcgt cgaggacctc       240
     gccgatccgt tctactcgca gatcagcgcc gccgtggagc gtgaggcgcg gatccaccgc       300
     tacctcctcg tgaccgcctc agcggagggc tcaccgaccc gcgagcgctc ggtcctcaag       360
     ggtctcgtcg cccggcgcgt cgacggcctg gtcgtcgtgc cggccggcga gacaccggtc       420
     gccgacccga cggtcatctc gagccggacc ccggttgtct acctcgaccg gcccgtcctc       480
     agcgagacac cggtcgacac cgtgctgtcg gacaacctcg gcggcatccg cagcgccgtg       540
     gagcacctcg tcgcccacgg gcaccggcgg atcggcttcc tcggtgactc gccggacgtc       600
     tggaccgcgc ggcagcgccg tgaggggttc atcacgacgc tccgcgacct ccggctgccc       660
     ggcaccccgc tcgtcgccat gggtccgcac acccccgaga cggtgcggac cgccctgacc       720
     cggtggacgt caggcgccga cccggtcacc gctgtcatca ccggcaacac ccgcgtgacg       780
     atcccggccc tcacgtccct gcaccactgg gcgacgcagc tctcgtacgt cgcctacgac       840
     gacttcgagc tgtccgacgt cgtcgagccc gccgtcaccg tcgtccacca ggacccggcc       900
     gcgatgggcc agaaggcagc gcagcagctc ttcgcccggc tgctcggcga cgagggtccg       960
     gcccaggtcg tcgtcctgcc cacccgtctc atcgtccgtg cgtcaggcgt gccacggcat      1020
     cccggccgtg acgtgcggac cgtgagcgcc tcatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page