(data stored in ACNUC7421 zone)

EMBL: CP002343.PE74

CP002343.PE74        Location/Qualifiers
FT   CDS_pept        83226..84536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0074"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pak:HMPREF0675_5030 bacterial extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Bacterial extracellular solute-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46636"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN5"
FT                   /protein_id="ADU46636.1"
FT                   /translation="MRNRSVATVAIATIAALGLAACGSSNEPTPTPGGDTSSLATTSGG
FT                   AGGEVGVFTWWAAGSEKKGLDELEKLFKEKYPNDTFVNLAVAGGAGSNAKAKLASDLQN
FT                   NQPPGSFQGHAGAELLDYIDAEQIEPVNDVIAALGGDKVFPKSLLDRLTVDGNIYSVPS
FT                   NIHRANVVWANTEVLKNAGINAVPTDIKGWIADMEKVKASGVATPLSVAGTWTQLQLFE
FT                   TVLISDLGVDKYNGLFDGKTAWDSPEVKQAAADYKTLLTYANTASDGDDWPVATDMVID
FT                   GKAAYNVMGDWAVAEFAAKGKKEQTDYQYFAVPGQEGVFDFLADSFTLPKGTKNPGGTK
FT                   DWLMLIGSAEGQKAFNLAKGSIPARTDVPATDFPPYQQSAMEAFKTNDIVSSIAHGAAV
FT                   SLAWNADMSTAISKFYTTKDDAGLVTDLTAAAKKYLP"
     atgcgcaaca ggtctgttgc aaccgtggcg atcgcgacga tcgccgccct cggcctcgcc        60
     gcgtgcgggt cgtcgaacga gccaaccccg acgccgggtg gtgacacgtc gtcgctggcg       120
     acgacgtccg gcggagccgg tggcgaggtc ggcgtcttca cctggtgggc cgcgggctcc       180
     gagaagaagg gcctcgacga gctggagaag ctcttcaagg agaagtatcc caacgacacg       240
     ttcgtcaacc tcgccgtcgc cggtggcgcg ggctcgaacg ccaaggccaa gctggcctcg       300
     gacctgcaga acaaccagcc gcccggctcc ttccagggcc acgcgggcgc ggagctgctc       360
     gactacatcg acgcggagca gatcgagccg gtcaacgacg tcatcgccgc gctcggtggc       420
     gacaaggtct tcccgaagag cctcctcgac cgcctcacgg tggacgggaa catctactcg       480
     gtgccgtcca acatccaccg cgcgaacgtc gtgtgggcca acaccgaggt gctcaagaac       540
     gccgggatca acgccgtccc gacggacatc aagggctgga tcgccgacat ggagaaggtc       600
     aaggcctccg gagtcgccac gccgctgtcc gtcgccggta cgtggacgca gctgcagctc       660
     ttcgagaccg tcctcatctc ggacctcgga gtcgacaagt acaacggcct cttcgacggc       720
     aagaccgcgt gggactcccc cgaggtgaag caggccgcag ccgactacaa gacgctgctg       780
     acctacgcca acaccgcctc cgacggtgac gactggcccg tcgcgaccga catggtcatc       840
     gacggcaagg ccgcgtacaa cgtcatgggg gactgggccg tggccgagtt cgccgccaag       900
     ggcaagaagg agcagaccga ctaccagtac ttcgccgttc ccggccagga gggcgtcttc       960
     gacttcctcg ctgactcgtt caccctcccc aagggcacga agaaccccgg cggcacgaag      1020
     gactggctca tgctgatcgg ctcggccgag ggccagaagg ccttcaacct ggccaagggc      1080
     tccatccccg cccgcaccga cgtgccggcg acggacttcc cgccctacca gcagtccgcc      1140
     atggaggcgt tcaagacgaa cgacatcgtc tcgtcgatcg cccatggtgc ggccgtgtcc      1200
     ctggcgtgga acgctgacat gagcaccgcg atcagcaagt tctacacgac caaggacgac      1260
     gctgggctcg tcaccgacct gaccgctgcg gccaagaagt acctgccctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page