(data stored in SCRATCH zone)

EMBL: CP002343.PE75

CP002343.PE75        Location/Qualifiers
FT   CDS_pept        84635..85549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0075"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: pac:PPA1965
FT                   binding-protein-dependent transport permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   permease; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46637"
FT                   /db_xref="GOA:E6SEN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN6"
FT                   /protein_id="ADU46637.1"
FT                   /translation="MRTATKVRDWLPGFLLVLPSVIVVGIFVYWLILQNVLTSLDRTVT
FT                   RATKRVTNPGGVENYTNLLGDDGYQHALFNLLVLTVVFVAGTMVFGLLWAVLLEKGVNA
FT                   EGVFRSVYLLPMAISFIAAGIVWRWLLSPGKGEQAVGLNQLLAMMGLERFQSSWWQSPN
FT                   TLSMAAMAIPAIWQLSGYVMALFLAGFRGISDDQREAARIDGATERQIYRHVLFPQLSP
FT                   IALSALIIIGHMSMKMFDLIYAIAGQNSYKASVPATLMWTQMFQQNNPTAAAANATILL
FT                   VLVALVVVPYLIYTNKTEKETRG"
     atgcgcacgg caaccaaggt ccgtgactgg ctgcccggct tcctgctggt gctcccgtcg        60
     gtcatcgtgg tggggatctt cgtctactgg ctcatcctcc agaacgtcct gacctcgctc       120
     gaccgcacgg tgacccgcgc gaccaaacgc gtgaccaacc ccggcggggt cgagaactac       180
     accaacctgc tcggcgacga cggctaccag cacgcgctct tcaacctcct ggtcctcacg       240
     gtcgtcttcg tcgcgggaac catggtcttc ggcctgctct gggccgtcct gctggagaag       300
     ggcgtcaacg cggaaggtgt cttccgctcg gtgtacctgc tcccgatggc gatctcgttc       360
     atcgcggccg gaatcgtctg gcgctggctc ctctctcccg gcaagggtga gcaggcggtc       420
     ggcctcaacc agctcctcgc gatgatgggg ctggagcggt tccagagctc gtggtggcag       480
     tcgccgaaca cgctgtcgat ggcggcgatg gcgatccccg cgatctggca gctctccggc       540
     tacgtcatgg cgctcttcct cgccggcttc cggggcatct ccgacgacca gcgcgaggcg       600
     gcccggatcg acggcgcgac cgagcggcag atctaccggc acgtcctctt cccgcagctg       660
     tcgccgatcg ccctgtccgc gctgatcatc atcggccaca tgtcgatgaa gatgttcgac       720
     ctcatctacg cgatcgccgg gcagaactcc tacaaggcct cggtccccgc gaccctcatg       780
     tggacgcaga tgttccagca gaacaacccg accgcggcgg cggccaacgc gacgatcctg       840
     ctcgttctcg tcgcgctcgt cgtcgtgccc tacctgatct acacgaacaa gacggagaag       900
     gagacccgcg gatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page