(data stored in ACNUC7421 zone)

EMBL: CP002343.PE76

CP002343.PE76        Location/Qualifiers
FT   CDS_pept        85546..86472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0076"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   pak:HMPREF0675_5028 ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Binding-protein-dependent
FT                   transport permease; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46638"
FT                   /db_xref="GOA:E6SEN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN7"
FT                   /protein_id="ADU46638.1"
FT                   /translation="MTTATAQTAPVAPGTDALGVRVSTGKAPGTEGTALGRTLRYALLI
FT                   LFVILILIPLYVLFVTSFKRSGDVNASQAWTFPSAWSIDGWRAAWDSLSPALFRSVILA
FT                   TSVAVLSASLGSLNGFVFAKWRFPGATTIFTLFLFGMFIPYQAVMIPLQGMLLDVQGTP
FT                   GFSWFDGIAKLIAVHVIFGIPICTLIFRNYYATALPNEILEAAKVDGAGMLRTFRSIVL
FT                   PISAPGFVVTMIWQFTSAWNDFLFALFLTNRNTGPVTYALNELAGGQNPDYPSIMAGVL
FT                   LASLPTLLVYILLGRYFIGGLMSGSVK"
     atgaccacgg caacggcaca gacggcgccg gtggccccgg gcactgacgc gctcggagta        60
     cgcgtctcca ccggcaaggc ccccggcacc gagggcacgg ccctgggtcg gaccctgcgc       120
     tacgcgctcc tcatcctctt cgtcatcctc atcctcatcc ccctctacgt cctcttcgtg       180
     acgagcttca agcggagcgg ggacgtcaac gcgagccagg cgtggacctt cccgagcgcc       240
     tggtcgatcg acggctggcg cgcggcctgg gactcgctct cgccggccct cttccggtcg       300
     gtgatcctcg cgacgtcggt ggcggtgctg tcggcgtcgc tcggctcgct caacggcttc       360
     gtcttcgcca agtggcgctt cccgggtgcg acgacgatct tcacgctctt cctcttcggg       420
     atgttcatcc cctaccaggc cgtgatgatc ccgctccagg ggatgctgct ggacgtccag       480
     ggcaccccgg gtttctcgtg gttcgacggg atcgccaagc tcattgccgt ccacgtcatc       540
     ttcggcatcc cgatctgcac gctgatcttc cggaactact acgccacggc gctgcccaac       600
     gagatcctcg aggcggccaa ggtcgacggt gccgggatgc tccggacctt ccgctccatc       660
     gtgctgccga tctcggcgcc cggcttcgtc gtgacgatga tctggcagtt cacctcggcg       720
     tggaacgact tcctcttcgc gctcttcctg acgaaccgca acaccgggcc ggtgacctac       780
     gcgctcaacg agctcgcggg tgggcagaac ccggactacc cgtcgatcat ggcgggcgtg       840
     ctgctcgcct cgctgccgac cctgctcgtc tacatcctgc tcggccggta cttcatcggc       900
     ggcctcatga gcggctccgt caagtag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page