(data stored in SCRATCH zone)

EMBL: CP002343.PE78

CP002343.PE78        Location/Qualifiers
FT   CDS_pept        87199..87957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0078"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675: IPR015837; KEGG: sna:Snas_2427
FT                   abortive infection protein; PFAM: Abortive infection
FT                   protein; SPTR: Abortive infection protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46640"
FT                   /db_xref="GOA:E6SEN9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR015837"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN9"
FT                   /protein_id="ADU46640.1"
FT                   /translation="MNATLEPMTVAAATRPVPPRRRPGLWATVVVVLVLVGLNLANHVF
FT                   GWGSLWLGPTGAVALLAFARFSGLTWRQLGLSRRTHASGLRWGLGVIGVVALVYLVGVL
FT                   VPQTRTAFLDARYHLPPASALLTAFVIIPVGTILLEEVAFRSVLWGFLSRHARVWQVAL
FT                   GSSLLFGLWHVLPASAAVTANPALGAVMVGLGAWQQVVSVAGTVLFTALGGLVAGELRR
FT                   RSGSILASVGMHWATNALGVLFGLVAWQLA"
     atgaatgcga ccctcgagcc gatgactgtc gcagccgcca ctcgccccgt gccgccccgg        60
     cgccgccccg gtctctgggc gacggtggtg gtcgtcctcg tcctcgtggg cctcaacctc       120
     gccaaccatg tgttcgggtg gggttccctc tggctcggac ccaccggcgc ggtcgccctg       180
     ctggccttcg cgcggttctc ggggctcacc tggcgccagc tcgggctgag ccgccgaacc       240
     cacgcgtccg ggctgcggtg gggcctcggc gtcatcggtg tcgtcgccct cgtctacctg       300
     gtcggggtgc tcgtcccgca gacccgcacc gccttcctcg acgcccggta ccacctgccg       360
     ccggccagcg ccctgctcac ggccttcgtc atcatccccg tcggcacgat cctcctcgag       420
     gaggtggcct tccgctcggt cctctggggc ttcctgtccc gacacgcccg ggtgtggcag       480
     gtggccctcg gctcgtcgct cctcttcggg ctctggcacg tgctgccagc ctcggccgcg       540
     gtcacggcca acccggccct cggcgcggtc atggtggggc tcggcgcctg gcagcaggtc       600
     gtcagtgtcg cggggacggt cctcttcacg gcgctcggcg gcctcgtcgc aggtgagctg       660
     cgccgccgca gcggcagcat cctggcgagc gtcgggatgc actgggcgac caacgccctg       720
     ggggtcctct tcggactcgt cgcctggcag ctggcctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page