(data stored in ACNUC7421 zone)

EMBL: CP002343.PE80

CP002343.PE80        Location/Qualifiers
FT   CDS_pept        complement(89441..90604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0080"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611; KEGG: art:Arth_2897 ribokinase-like
FT                   domain-containing protein; PFAM: PfkB domain protein; SPTR:
FT                   Putative carbohydrate kinase; PFAM: pfkB family
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46642"
FT                   /db_xref="GOA:E6SEP1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP1"
FT                   /protein_id="ADU46642.1"
FT                   /translation="MKGMPQNAYDPLASRRSPDAPEVDVFVWGTVFLDLVFAGLPTAPK
FT                   PGTEVWSEGLASCPGGIANLAVATRRLGLRTSLAAAFSDDDYGDFCWRTLEEQEGIDLC
FT                   RSRQFPEWHSPVTVSMAFGGDRAMVSHGHPPPVSSLELIGDPPRSRAVMVDLAESGLFE
FT                   PGDGTRGLGSAARAGESWVDAARRRGALVFADVGWDRDERWEPSVLDRLSHCDAFLPNA
FT                   IEAMAYTATSSPQEALFALADRVPIAVVTNGAEGALGIDARTGEEAQVPSLRVHEVDAT
FT                   GVGDVFAAAMLVGTLGEWPLADRMSFASLAAALALQQYGGSLAAPGWGDVADWWTGLCS
FT                   DACGDAYHRSLRRRYAFLDDIVPRVPVTACRRATATIARRADVDDLP"
     atgaagggga tgccgcagaa cgcctacgac ccactcgcat cccgacggtc acccgacgcg        60
     cccgaggtgg acgtcttcgt gtgggggacc gtcttcctcg acctcgtctt cgcggggctc       120
     ccgaccgctc cgaagccggg gaccgaggtg tggtccgagg ggctcgcgtc ctgcccgggt       180
     ggcatcgcca acctcgccgt ggccactcgg cgcctcgggc tgcgaacctc gctcgccgcg       240
     gcgttcagtg atgacgacta cggggacttc tgctggcgga ccctcgagga gcaggaaggg       300
     atcgacctct gccggagccg gcagttcccc gagtggcaca gccccgtgac cgtctcgatg       360
     gccttcggtg gggaccgcgc gatggtctcg cacggccacc caccgccggt ctcctccctg       420
     gagctcatcg gggacccgcc ccggtcccgg gccgtcatgg tcgacctcgc cgagagcggg       480
     ctcttcgagc ccggcgacgg aacccgtggg ctcggttcgg cggctcgcgc gggagagagc       540
     tgggtggacg ccgcgcggcg acgcggcgcc ctggtcttcg ccgacgtcgg atgggaccgg       600
     gacgagcggt gggagccctc ggtgctcgac cggctgagcc actgcgacgc cttcctgccc       660
     aacgccatcg aggcgatggc ctacaccgcg accagctcgc cgcaggaggc actcttcgcc       720
     ctcgccgacc gcgtgccgat cgccgtcgtg accaacggcg ccgagggagc cctgggcatc       780
     gacgcgcgca ccggtgagga ggcacaggtg ccctccctgc gggtccacga ggtggacgca       840
     accggggtcg gcgacgtctt cgccgccgcg atgctcgtcg gcacgctcgg cgagtggccg       900
     ctcgcggacc ggatgtcgtt cgccagcctc gccgccgccc tcgccctgca gcagtacggc       960
     ggctccctcg cggctcccgg gtggggtgac gtcgcggact ggtggaccgg cctgtgctcg      1020
     gacgcgtgtg gggacgccta ccaccggtcg ctccgccggc ggtacgcctt cctcgacgac      1080
     atcgtccccc gggtcccggt caccgcgtgc cgtcgggcca ccgcgacgat cgcccgacgt      1140
     gccgacgtgg acgatctgcc ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page