(data stored in ACNUC7421 zone)

EMBL: CP002343.PE81

CP002343.PE81        Location/Qualifiers
FT   CDS_pept        90606..91670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0081"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2951 Membrane-bound lytic murein
FT                   transglycosylase B; KEGG: sgr:SGR_1028 hypothetical
FT                   protein; SPTR: Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46643"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP2"
FT                   /protein_id="ADU46643.1"
FT                   /translation="MAQPGREVPWFSGFGPPGRLSPGNRAMAYAAGPEVSAAIPEQSDR
FT                   PPRIVDEVGVGSSRTKRAAGGAGGVAVLLCSVLTAPALAADTSPVPRPSPGAPVASQGV
FT                   ADPVAPVPPVAPIDPLGSGAGESLLRLYDVVKVTAGYVAATRLEPGGGSSRPGRDSAWQ
FT                   PPADLQTPPVTPGTAAGPGRRMTKYDVLGAAYQKAADALADSCQLPFAVLMAIGEVESG
FT                   SLRGRTLDVRHNVVPPIIGPALSGSGFAAIRDSDRGRLDGDPVWDRAVGPMQFIPGTWR
FT                   LWGADGNGDGVADPQNVEDAALSAGRYLCAGGRDLARQADLERAILSYNHSRRYLETVL
FT                   DLYDSVMGGAVAGP"
     atggcgcagc ccggccgcga ggtcccgtgg tttagcgggt tcgggccccc cggccggctc        60
     tccccgggta accgggcgat ggcgtatgcc gctgggcccg aggtgagtgc ggccatcccc       120
     gagcagtcgg accgaccgcc ccgtatcgtc gatgaggtgg gggtcgggtc gtcacggacg       180
     aagcgagcag ccgggggagc cgggggcgtc gcagtgctgc tgtgttctgt gctgaccgcg       240
     ccggcgctgg cagccgacac cagcccggtg ccgcgcccct cgcccggtgc cccggtggca       300
     tcgcagggcg tggcggatcc tgtcgccccc gtccctcccg tcgccccgat cgacccgctc       360
     gggtccggcg ccggcgagtc gctgctccgc ctctacgacg tcgtcaaggt gaccgcgggc       420
     tatgtcgcgg cgacccgtct cgagccggga ggcggatcct ctcgcccggg gcgcgactcg       480
     gcctggcaac ccccggccga cctgcagacc ccgcccgtca caccgggaac ggccgccggg       540
     cccgggcgaa ggatgacgaa gtacgacgtc ctcggggccg cttaccagaa ggcggccgac       600
     gcgctggctg acagctgcca gcttcccttc gccgtgctga tggccatcgg cgaggtggag       660
     tccggctccc tccggggccg caccctggac gtccgccaca acgtcgtgcc accgatcatc       720
     ggtccggcac tcagcggaag cggcttcgct gcgatccgcg acagtgacag gggccggctg       780
     gacggagacc ccgtctggga ccgggccgtg ggcccgatgc agttcatccc cggaacgtgg       840
     cggctgtggg gcgcagacgg caacggggac ggggtcgcgg acccccagaa cgtcgaggac       900
     gccgcgctct ccgcgggccg ctacctctgc gcgggtggac gggacctggc tcgccaagcc       960
     gatctggaga gggcgatcct gtcctacaac cactcccgcc gctacctcga gacggtgctc      1020
     gacctctacg actccgtcat ggggggcgcc gtcgccggac cgtga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page