(data stored in ACNUC7421 zone)

EMBL: CP002343.PE84

CP002343.PE84        Location/Qualifiers
FT   CDS_pept        94318..95556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0084"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR000878: IPR006367: IPR006366; KEGG:
FT                   aau:AAur_3076 uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; SPTR: Uroporphyrin-III
FT                   C-methyltransferase, C-terminal:Siroheme
FT                   synthase,N-terminal; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46646"
FT                   /db_xref="GOA:E6SEP5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP5"
FT                   /protein_id="ADU46646.1"
FT                   /translation="MKSALPLVVDLTGRLVVAVGGGPVSARRVRAFVDEGAVVRVVSPW
FT                   VCEDLRDLVLDGTVEWQARDYTGAGDLDGAWLVHTAVGEPEVDRRVAGDAERLRIWCVD
FT                   ATDASARSASVAARTDVATPDGRVTISTYAAGDPGLATSLRDGVAEAVTQGRLDLRRTR
FT                   ERVSADAKPSGWVALVGGGPGSDGLLTARGHELLRSADVVVVDRLAPRGLLERLPASVR
FT                   VVDVGKTPGHHAVPQWRINEILVEEASRGLGVVRLKGGDPYVLGRGGEERQACEAAGLA
FT                   VEVVPGVTSAVSVPAAAGIPVTHRGVARGFTVVTGHEAIPGLPTGGDHTLVLLMGVSLL
FT                   EQTVTALVAQGRSLDSPVAIVERGFSPTQRTTVGTLSSIAELAREREVGSPAVIVVGDV
FT                   VRLSPEWPGDPAG"
     atgaagtccg ccctgcccct ggtcgtcgac ctgaccggac gcctcgtcgt cgccgtcggc        60
     ggcggacccg tgtcggctcg acgggtccgt gccttcgtcg acgagggcgc ggtcgtccgg       120
     gtcgtctcgc cgtgggtgtg cgaggacctg cgcgacctgg tcctcgacgg cacggtcgag       180
     tggcaggcac gcgactacac gggggccggc gacctcgacg gagcctggtt ggtccacacg       240
     gccgtcggcg aaccggaagt ggaccgacgc gttgcgggcg acgccgagcg cctgcgcatc       300
     tggtgtgtgg acgcgacgga tgcgtccgcg aggtccgcca gcgtcgccgc ccgcacggac       360
     gtggccaccc cggacggccg ggtcaccatc agcacgtatg ccgctgggga ccccggtctg       420
     gcgacctccc ttcgcgacgg ggttgcggaa gcggtgaccc agggccggct cgacctccgc       480
     aggacgcgcg agcgcgtgtc ggccgacgcc aagccctcag ggtgggtcgc gctcgtcggg       540
     ggcggtccag gcagcgacgg cctcctcacg gctcgcggtc acgagctgct gcgctccgcc       600
     gacgtcgtcg tcgtcgaccg gctcgcaccc cgcgggctcc tcgagcggct gcccgcctcc       660
     gtgcgggtcg tcgacgtcgg caagacgccc ggccaccacg cagtgccgca gtggcggatc       720
     aacgagatcc tcgtcgagga ggcgtcccgg gggctcggcg tcgtgcgtct caagggcggt       780
     gacccctacg tcctcggacg gggcggcgag gagcggcagg cgtgcgaggc cgcagggctg       840
     gctgtcgagg tcgtcccagg ggtgacgagc gccgtgtccg tccccgcggc cgccgggatc       900
     cccgtgacgc accgcggggt cgcacgcggc ttcaccgtgg tcacggggca cgaggcgatc       960
     ccggggctcc cgacgggcgg cgaccacacg ctcgtcctcc tcatgggcgt cagcctcctc      1020
     gagcagacgg tgacggccct cgtggctcaa ggccgctcgc tcgactctcc ggtcgcgatc      1080
     gtcgagcgag gcttctcgcc gacgcagcgg accaccgtcg gcaccctgtc ctccatcgcg      1140
     gagctggccc gcgagcgcga ggtcgggtca ccggccgtca tcgtcgtcgg ggacgtggtc      1200
     cggttgagcc cggagtggcc gggggaccct gcgggctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page