(data stored in ACNUC7421 zone)

EMBL: CP002343.PE85

CP002343.PE85        Location/Qualifiers
FT   CDS_pept        complement(95588..96565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0085"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG0510 choline kinase involved in LPS
FT                   biosynthesis; InterPro IPR002575; KEGG: scb:SCAB_38761
FT                   putative phosphotransferase; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Putative phosphotransferase;
FT                   PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46647"
FT                   /db_xref="GOA:E6SEP6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP6"
FT                   /protein_id="ADU46647.1"
FT                   /translation="MAAAVVTVAEPRMLSTADAEAVAAAFGLGPDAVLDGPVARGQLGR
FT                   IWRLRADGTSWAVKEWFAPPDVTAVEAHHEFSEAALAAGVFTPRSRPSVHGTVLADVSG
FT                   TPVRVTEWVDLAPRSRRLDPAEVGRTVAHLHRAGGPTDERVGNWFATGVGAVGWHDMHR
FT                   RLVAARAPFADELEELLPDLVAVESVIEPHEQPRVCHRDLWADNVLASADGRVCIIDFE
FT                   NMGPADPAQELAMVLFEFGDDDPERARLVHAAYVDAGGPARVSRRGHFTMLVAEQAHIT
FT                   TYACARWIGESDVAERARLEAWFRETPEDPVTLARIDRVLAAVT"
     gtggcagctg ctgtcgtgac cgtcgccgag ccccggatgc tctccaccgc cgatgccgag        60
     gcggtcgcgg ccgcgttcgg cctcggaccc gacgccgtcc tcgacggacc cgtcgcccgc       120
     ggccagctcg ggcgaatctg gagactgcga gcggacggca cttcgtgggc ggtcaaggag       180
     tggttcgcgc cccccgacgt cacggcggtc gaggctcacc acgagttctc ggaggctgct       240
     ctggcggccg gcgtcttcac gccccgttcc cgcccgtcgg tccacggcac cgtcctcgcc       300
     gacgtctccg gcacaccggt gcgcgtcacc gagtgggtgg acctggcccc gcgcagccgc       360
     cggctcgacc ccgccgaggt ggggcggacg gtcgcacacc tgcaccgggc tggaggcccc       420
     accgacgagc gggtcggcaa ctggttcgcc accggcgtcg gagcggtggg gtggcatgac       480
     atgcaccggc gactcgtcgc ggccagggcg cccttcgcag acgagctcga ggagctcctg       540
     cccgacctcg tggcggtcga gagcgtcatc gagccgcacg agcagccccg ggtctgccac       600
     cgcgacctct gggccgacaa cgtccttgcg agcgcagacg gacgcgtgtg catcatcgac       660
     ttcgagaaca tgggcccggc cgaccccgcg caggagctcg ccatggtgct cttcgagttc       720
     ggcgacgacg atcccgagcg cgctcggctg gtgcacgccg cgtacgtcga cgccggtggt       780
     ccggcccggg tcagccggcg cgggcacttc accatgctcg tcgcggagca ggcccacatc       840
     accacctatg cgtgcgcccg gtggatcggc gagagcgacg tcgccgagcg cgcccggctc       900
     gaggcgtggt tccgagagac gcccgaggac ccggtgaccc tcgctcggat cgaccgggtc       960
     ctcgctgccg tcacctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page