(data stored in ACNUC7421 zone)

EMBL: CP002343.PE88

CP002343.PE88        Location/Qualifiers
FT   CDS_pept        complement(97861..98313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6437 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46650"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP9"
FT                   /protein_id="ADU46650.1"
FT                   /translation="MGCLLRSRSYCVYAVTMSPKSPSPVALALAAVEDALRHVDPDRPS
FT                   AALPHLRAAQDHLTRAIDEAMATAVLAEGSTIRTAGSLAGLSENAVGPRLARTSLLSAY
FT                   AGPDSGRVTASGVERARYDLEEGRHRRTDPGADPSRPMRFRARRPT"
     atggggtgcc tcttgcgttc ccgcagttac tgcgtctacg ctgtaaccat gtcaccgaag        60
     tcaccgagtc ctgtcgccct ggcgcttgcg gccgtcgagg acgccttgcg gcacgtcgat       120
     cccgaccggc cgagcgctgc gctgccccac ctccgggcgg cccaggacca cctcacccga       180
     gcgatcgacg aggcgatggc gactgcagtc ctcgcagagg ggagcacgat ccggacggcc       240
     ggttccctgg ccggcctctc cgagaacgcc gtcggccccc gcctcgcgag gacctcgctc       300
     ctctcggcct atgcaggacc ggacagcggc cgggtcaccg cctccggggt cgagcgggcc       360
     cggtacgacc tggaggaggg ccgccaccgc cgcaccgacc ccggcgccga cccaagccga       420
     ccgatgcgct tccgggcgcg ccggcccacc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page