(data stored in SCRATCH zone)

EMBL: CP002343.PE89

CP002343.PE89        Location/Qualifiers
FT   CDS_pept        complement(98442..99167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0089"
FT                   /product="Anti-sigma K factor RskA"
FT                   /note="InterPro IPR018764; KEGG: nca:Noca_4536 hypothetical
FT                   protein; PFAM: Anti-sigma K factor RskA; SPTR: Putative
FT                   uncharacterized protein; PFAM: Anti-sigma-K factor rskA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46651"
FT                   /db_xref="GOA:E6SEQ0"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ0"
FT                   /protein_id="ADU46651.1"
FT                   /translation="MTDDIHALSGAYAVDALDELERVQFEQHLAGCPACRAEVAGLREA
FT                   AAQLAAGVELPPPPALRGRLMSAIAEARPLPPVRAAAPATEAANVAASPARPWRRVLVA
FT                   AAAAAVLGVTGVGIWQAREGTPAPTVAEQVLDAPDAMRTSQSFTGGATATVVRSPSLGR
FT                   AVLVTSRMPAAPDGKVYQLWLQDSTGHMVSAGVMPAGPDQVVVLQGDARTATAAGISVE
FT                   PTGGSQQPTTDPIALFAFT"
     atgaccgatg acatccacgc gctgtccggc gcctacgccg tcgatgcgct cgatgagctg        60
     gagagggtgc agttcgagca gcacctcgcc ggctgcccgg cctgtcgggc ggaggtcgcg       120
     ggactccgcg aagccgccgc ccagctcgct gccggcgtcg agctgccccc gccaccggcg       180
     ctgcgcgggc gcctcatgag cgccatcgct gaggcccgtc cgctgccacc ggttcgtgcc       240
     gccgcgccgg ccaccgaggc ggccaacgtg gcggccagcc cggcgcgacc atggcgtcgg       300
     gtcctggtcg ccgccgcagc ggcggccgtc ctgggcgtga ccggggtcgg gatctggcag       360
     gcccgggagg gcactccggc cccgaccgtc gccgaacagg tgctcgacgc gccggatgcg       420
     atgcggacca gccagtcgtt cacgggtggg gcgacggcca ccgtcgtccg ctcgccgtcc       480
     ttgggcaggg ccgtcctcgt gacctcgcgg atgccggccg caccggatgg caaggtgtac       540
     cagctgtggc tacaggactc caccggtcac atggtctcgg cgggggtcat gcccgccggc       600
     ccggaccagg tggtcgtcct ccagggcgac gcgcgcactg ccacggcggc ggggatctcg       660
     gtcgagccca ccggcggctc ccagcagccg acgaccgacc cgatcgcgct cttcgccttc       720
     acctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page