(data stored in SCRATCH zone)

EMBL: CP002343.PE9

CP002343.PE9         Location/Qualifiers
FT   CDS_pept        10916..13030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0009"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR003594: IPR013506: IPR006171: IPR002288: IPR
FT                   011557: IPR001241: IPR018522: IPR000565; KEGG:
FT                   kse:Ksed_00060 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; PRIAM: DNA topoisomerase (ATP-hydrolyzing); SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein; SPTR: DNA gyrase subunit B; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46571"
FT                   /db_xref="GOA:E6SDW8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW8"
FT                   /protein_id="ADU46571.1"
FT                   /translation="MSDAAETTADSTNRPNVDHRPNGVDYDASAITVLEGLEAVRKRPG
FT                   MYIGSTGERGLHHLVYEIVDNSVDEALAGYADTIDITLLADGGVRVKDNGRGIPTDIHP
FT                   VEKMSAVELVLTQLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTTLKVAVRQKGYVHRM
FT                   SFTMGVPDGPLRREEATDETGTTITFWPNAEIFDSVDFDFETLRARLQQMAFLNKGLTL
FT                   NLVDERVDQRAEASEDVDLDGVESDLATVVEDGDNGHDVPTSGRKTLTAKTATYRYDGG
FT                   LVDYVNHLNSSKRSEPVHPEVIAIEVEDEARSLSLELAMQWTSAYSESVHTYANTINTH
FT                   EGGTHEEGFRAAMTKLINDFARKQNLLKEKDENLTGDDVREGLTAVISVKLGDPQFEGQ
FT                   TKTKLGNSEVKGFVQRAMTDEFGHWLETHPNEGKDIVRKSIQAAAARMAARKAREATRR
FT                   KGLLESGGLPGKLKDCQSKDPSLSEVFIVEGDSAGGSATQARNPHIQAILPIRGKILNV
FT                   EKARIDKILANQEVQALISAFGTGIGEDFDLAKARYHKIILMADADVDGMHIRTLLLTL
FT                   LFRFMRPLIEAGYVYLAQPPLFRLRWSNAPHQFAYSDRERDGLTELGKANGWRLPKDNP
FT                   VQRYKGLGEMNYQELGETTMDQSTRTLLQVTLDDAAKADEVFAVLMGEDVESRRTFIQK
FT                   NARDVRFLDI"
     gtgtcagacg ccgccgagac gaccgccgac agcaccaacc gaccgaacgt cgaccatcgt        60
     cccaacggag tcgactacga cgcgagtgcg atcaccgtcc tcgaggggct cgaggcggtg       120
     cgcaagcgcc cggggatgta catcggctcg accggtgagc gggggctgca ccacctcgtc       180
     tacgagatcg tcgacaactc cgtcgacgag gcgctcgccg gctacgccga cacgatcgac       240
     atcaccctgc tcgccgacgg cggggtccgg gtcaaggaca acgggcgtgg cattcccacc       300
     gacatccacc cggtcgagaa gatgagcgcg gtcgagctgg tgctcaccca gctgcacgcg       360
     ggcgggaagt tcggcggcgg cggctacaag gtgtccggcg gcctgcacgg cgtcggctcg       420
     tccgtcgtca acgccctgtc gaccacgctc aaggtcgcgg tccggcagaa gggctacgtc       480
     caccggatga gcttcaccat gggggtgccg gacggtccgc tccgccggga ggaggccacc       540
     gacgagaccg gcacgacgat caccttctgg cccaacgccg agatcttcga cagtgtcgac       600
     ttcgacttcg agacgctgcg tgcccgtctc cagcagatgg ccttcctcaa caagggcctg       660
     accctcaacc tcgtcgacga gcgggtcgac cagcgtgccg aggcctccga ggacgtggac       720
     ctcgacggag tggagagcga cctcgcgacg gtggtcgagg acggcgacaa cggccatgac       780
     gtccccacga gcgggcggaa gaccctgacg gccaagacgg ccacctaccg ctacgacggc       840
     ggcctcgtcg actacgtcaa ccacctcaac tcctccaagc gcagcgagcc cgtgcatccc       900
     gaggtgatcg ccatcgaggt cgaggacgag gcgcgctccc tgtccctcga gctggcgatg       960
     cagtggacca gcgcctacag cgagtcggtg cacacctacg cgaacacgat caacacccac      1020
     gagggcggca cccacgagga gggcttccgt gcggcgatga ccaagctcat caacgacttc      1080
     gcgcgcaagc agaacctcct caaggagaag gacgagaacc tcaccggcga cgacgtccgg      1140
     gaaggcctca ccgcggtcat ctcggtcaag ctcggtgacc cccagttcga gggacagacc      1200
     aagacgaagc tcggcaactc cgaggtcaag ggcttcgtcc agcgcgccat gaccgacgag      1260
     ttcgggcact ggctcgagac ccaccccaac gagggcaagg acatcgtccg caagtcgatc      1320
     caggccgcgg ccgcccggat ggcggctcgc aaggctcgcg aggcgacccg gcgcaagggc      1380
     ctgctcgagt ccgggggcct gccgggcaag ctcaaggact gccagagcaa ggacccgagc      1440
     ctctccgagg tgttcatcgt cgagggtgac tccgccgggg ggtcggcgac gcaggcccgc      1500
     aacccgcaca tccaggcgat cctgccgatc cgcggcaaga tcctcaacgt cgagaaggcc      1560
     cggatcgaca agatcctcgc caaccaggag gtccaggcgc tgatctcggc cttcggcacg      1620
     ggaatcggcg aggacttcga cctcgccaag gcccgctacc acaagatcat cctgatggcc      1680
     gacgccgacg tcgacgggat gcacatccgc accctcctgc tgacgctgct cttccgcttc      1740
     atgcggccgc tcatcgaggc cggctacgtc tacctggccc agccgcccct gttccgtctc      1800
     cggtggagca atgccccaca ccagttcgcc tactccgacc gggagcggga cggtctcacg      1860
     gagctgggca aggcgaacgg ctggcgcctg ccgaaggaca accccgtcca gcggtacaag      1920
     ggcctcggcg agatgaacta ccaggagctc ggcgagacga ccatggacca gagcacccgc      1980
     acgctgctcc aggtgaccct cgacgacgcg gccaaggccg acgaggtgtt cgcggtgctc      2040
     atgggtgagg acgtcgagtc acggcggacc ttcatccaga agaacgcccg ggacgtgcgg      2100
     ttcctcgaca tctga                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page