(data stored in ACNUC7421 zone)

EMBL: CP002343.PE90

CP002343.PE90        Location/Qualifiers
FT   CDS_pept        complement(99164..99814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0090"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014284; KEGG: nca:Noca_4535 RNA
FT                   polymerase sigma factor SigK; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: RNA
FT                   polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46652"
FT                   /db_xref="GOA:E6SEQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ1"
FT                   /protein_id="ADU46652.1"
FT                   /translation="MARFSVVPSGDASSPGAATGPVAPVEPVEPVEPFEPIELGDLLGR
FT                   AATGDEGAFGEFYDRTSARVHGLVRRVVRDPAQSEEVTQEVFLELWRQSARYDSGKGSV
FT                   LAWVMTIAHRKAVDRVRSSESARGRDAAYGAATVDVAHDHTSEVAVQRLEGERVRRALG
FT                   SLTEAQRRAVELAYLSGYTHTEVAGLLDLPLGTAKTRIRDGLIRLRDTLGVTS"
     atggctcggt tctcggtggt cccctccggc gacgcctcgt cgccgggggc ggccaccggc        60
     cccgtcgcgc cggtcgagcc ggtcgagccg gtcgagccgt tcgagccgat cgagctgggc       120
     gacctgctcg ggcgggccgc gaccggcgac gagggggcgt tcggcgagtt ctacgacagg       180
     acgtcagccc gggtgcacgg gctggtccgc cgcgtcgtcc gtgacccggc gcagtccgag       240
     gaggtcaccc aggaggtctt cctcgagctg tggcgtcaga gcgcgcgcta cgactccggc       300
     aagggcagcg tgctcgcctg ggtcatgacc atcgcgcacc gcaaggccgt cgaccgggtc       360
     cggtcgtccg agtccgcacg cggccgggac gcggcctacg gcgcggcgac cgtggacgtc       420
     gcccatgacc acacgtcgga ggtggccgtg cagcggctcg agggggagcg cgtgcgccgc       480
     gcgctgggct cgttgaccga ggcccagcgc cgagccgtcg agctcgccta cctctccggc       540
     tacacgcaca ccgaggtcgc cggcctcctc gacctgcccc tcggcacggc caagacccgg       600
     atccgggacg gcctcatcag acttcgagac acgttggggg tgacctcatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page