(data stored in SCRATCH zone)

EMBL: CP002343.PE91

CP002343.PE91        Location/Qualifiers
FT   CDS_pept        complement(99870..100511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0091"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="COGs: COG2335 Secreted and surface protein
FT                   containing fasciclin-like repeats; InterPro IPR000782:
FT                   IPR017909; KEGG: nca:Noca_4534 beta-Ig-H3/fasciclin; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin; SPTR:
FT                   Beta-Ig-H3/fasciclin; PFAM: Fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46653"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ2"
FT                   /protein_id="ADU46653.1"
FT                   /translation="MNTRRTALALALVLPLGLAACGSAEPEAPTAAPAMTSSAPTTTGS
FT                   SSATSAATTDPAAQVFGSACSAVPSDGKGSFSGMATDPVATAASNNPLLSTLVTAVTEA
FT                   GLVDTLNSAPDVTVFAPVNDAFAKIPEADLKAVLADKPTLTKILTNHVVAGSLSPDELA
FT                   GTHETLAGTTLTVEPSGDSFTVGKERATVLCGNVPTANATVYIIDTVLMP"
     atgaacaccc gtcgcactgc actcgccctg gccctcgtcc tcccgctcgg gctcgccgcc        60
     tgcggcagcg ccgagccgga ggcgcccacc gccgcaccgg cgatgacctc gtcggcaccc       120
     acgaccactg gatcgtccag cgcgacctcg gccgcgacga cggaccctgc cgcgcaggtc       180
     ttcggctccg cgtgctccgc cgtgccgagc gacggcaagg gctcgttcag cgggatggcc       240
     accgacccgg tcgccaccgc cgcgagcaac aacccgctcc tcagcaccct cgtcaccgcc       300
     gtcacggagg cggggctcgt cgacaccctc aactccgccc ccgacgtcac cgtcttcgcg       360
     cccgtcaacg acgccttcgc caagatcccc gaggcggacc tcaaggcggt cctcgccgac       420
     aagccgaccc tgacgaagat cctcaccaac cacgtcgtcg ccggctcgct gtcgcccgac       480
     gagctggccg gcacccacga gaccctcgcc ggcacgacgc tgacggtgga gccctcgggt       540
     gactcgttca cagtcggcaa ggagcgggcg accgtcctct gcggcaacgt gccgacggcc       600
     aacgcgaccg tctacatcat cgacacggtg ctcatgccat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page