(data stored in ACNUC7421 zone)

EMBL: CP002343.PE92

CP002343.PE92        Location/Qualifiers
FT   CDS_pept        complement(100594..102114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0092"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR006311; KEGG: nca:Noca_4533 oxidoreductase,
FT                   molybdopterin binding; PFAM: oxidoreductase molybdopterin
FT                   binding; Mo-co oxidoreductase dimerisation domain; SPTR:
FT                   Oxidoreductase, molybdopterin binding; PFAM: Mo-co
FT                   oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46654"
FT                   /db_xref="GOA:E6SFB6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB6"
FT                   /protein_id="ADU46654.1"
FT                   /translation="MGRTNHAGIGVLAASAGLAAGHLSASVDEPAASPLVAVGTAVIDA
FT                   APTPLKELAVATLGTADKPVLIGSVLAITLAVAGLIGILARRRLWVAGALLSALVMVGG
FT                   LAALARPTATARDAVPALAALVVGVGVLVGLTELSRRTVPAGTRPGPAAGRGVSRRAVV
FT                   GASVGVAVGSVLAGVGGQVRATARAARDLVLPRPLVPAAPLPTGLDASVRGISPLQTPT
FT                   DRFYRVDVNLTVPRIDHDSWSLDIDGMVERPLRLTYADLTRMRLVERDITLTCVSNEVG
FT                   GGYVSSGRWLGVLVSDLLEAAGVSGPAEQVLSTAVDGFTISTPLRALTDGRHALVAIGL
FT                   NGAPLPDEHGFPARLVTPGLYGFVGATKWLRRLTVTTYAAEQAYWTRRQWATEAPVKTS
FT                   ARIDTPAPLSTVPSGRVAIGGVAWAQHRGVAAVEVRIDDGLWQPARLGPDIGVDCWRQW
FT                   YLPWDAKPGLHRLAVRATDRTGDVQTADRAAPFPDGSSGIQEVVVTVS"
     atgggacgaa ccaaccacgc cggcatcggc gtcctcgccg cctcggccgg actcgcagcc        60
     ggccacctct ccgcgtcggt ggacgagccg gccgcctccc cgctcgtcgc ggtggggacc       120
     gccgtcatcg acgcggcgcc gaccccgctc aaggagctgg ccgtcgcgac cctgggcacg       180
     gccgacaagc cggtcctcat cgggtcggtc ctcgccatca ccctcgcggt ggcgggactc       240
     atcggcatcc tggcccggcg ccggctgtgg gtggccgggg cgctcctgag cgccctcgtc       300
     atggtgggcg gcctcgctgc cctggcgcgc ccgacggcga cggcgcgcga cgccgtaccc       360
     gcgctggccg ccctcgtcgt cggcgtcggg gtcctcgtgg ggctgacgga gctgtcccgc       420
     cgcacggtcc ccgccgggac gcgccccggg ccggcggcag ggcgaggggt gtcgcgccgc       480
     gccgtggtgg gcgcttcggt cggggtggcc gtcggctcgg tcctggccgg cgtcggcggc       540
     caggtccggg cgacggcgcg ggcggcgcgc gacctggtgc tgccccggcc cctggtgccc       600
     gccgcaccac tgccgaccgg cctcgacgcg tcggtgcggg ggatctcgcc gctgcagacc       660
     ccgaccgatc ggttctaccg ggtcgacgtc aatctcaccg tcccacgcat cgaccacgac       720
     tcgtggtccc tcgacatcga cgggatggtc gagcggccgt tgcggttgac gtacgccgac       780
     ctgacccgga tgcgcctcgt cgagcgcgac atcaccctga cgtgcgtctc caacgaggtc       840
     ggcgggggct atgtgtcgtc cggcaggtgg ctcggtgtgc tcgtctcgga cctgctcgag       900
     gccgcgggcg tctccggccc ggccgagcag gtcctgagca cggcggtcga cggcttcacg       960
     atcagcacgc cgctccgcgc gctcaccgac gggcggcacg ccctcgtcgc catcggcctc      1020
     aacggcgcgc cgctcccgga cgagcacggc ttccccgcgc ggctggtcac ccctggcctc      1080
     tacgggttcg tgggggcgac caagtggttg cgccggctca cggtgacgac ctatgccgcc      1140
     gagcaggcgt actggacccg acggcagtgg gccacggagg cgccggtgaa gacgagcgcc      1200
     cggatcgaca ccccggcacc gctgtcgacg gtcccgagcg gccgggtcgc gatcggcggg      1260
     gtcgcctggg cccagcaccg gggcgtcgcc gcggtcgagg tgcgcatcga cgacggcctg      1320
     tggcagcccg ctcgactcgg cccggacatc ggggtggact gctggcgaca gtggtacctg      1380
     ccgtgggacg cgaagccggg gctccaccgc ctggccgtcc gcgccaccga ccggaccggg      1440
     gacgtccaga cggccgaccg ggccgctccc ttccccgacg gctccagcgg catccaggag      1500
     gtcgtcgtca ccgtcagctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page