(data stored in SCRATCH zone)

EMBL: CP002343.PE93

CP002343.PE93        Location/Qualifiers
FT   CDS_pept        complement(102172..102615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6177 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Polyketide cyclase
FT                   / dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46655"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB7"
FT                   /protein_id="ADU46655.1"
FT                   /translation="MATFRVWVSSAVPPDEAWRRVLDLRAHDRVIPLTRVTTGRSAAAD
FT                   LTAGSRFVARTGMGPVGFDDAMVVESITPPRAAEPGSARIRKEGKVVRGSIDLHVQATP
FT                   GGSAVSWTQDIDVRGVPRALGWLTVGASRAAYGWALRRLLRGD"
     atggcgacgt tccgggtctg ggtctcctcg gccgtgccgc ccgacgaggc gtggcgacgg        60
     gtcctcgacc tccgcgccca cgaccgggtg atcccactga cccgcgtcac caccgggagg       120
     tccgccgcgg ccgacctcac agccggatcg cgcttcgtcg cgaggacggg aatggggccg       180
     gtgggcttcg acgatgcgat ggtcgtcgag tcgatcactc cgccccgggc cgctgagccc       240
     gggtcggccc ggatccgcaa ggagggcaag gtggttcgcg gctcgatcga cctccacgtg       300
     caggccacac cgggcgggtc ggcggtctcc tggacccagg acatcgacgt ccggggggtc       360
     ccccgagcgc tcggatggct gaccgtggga gcgagccgag cggcatacgg ctgggccctc       420
     cgacggctgc tccgcggcga ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page