(data stored in SCRATCH zone)

EMBL: CP002343.PE94

CP002343.PE94        Location/Qualifiers
FT   CDS_pept        102732..103565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0094"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: nml:Namu_1402 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Alpha/beta
FT                   hydrolase fold protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46656"
FT                   /db_xref="GOA:E6SFB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB8"
FT                   /protein_id="ADU46656.1"
FT                   /translation="MSTRTTTLHGHRLAYVDRGAGPAVLFIHGLLGTNANWSHLVTRLE
FT                   TTHRVVVPDLFGHGASDKPRGDYSLGAHAATLRDLLDRLDIDRVTLVGHSLGGGIALQL
FT                   CYLFPERVDRLVLVSSGGLGRSVSPILRAATLPGAEVVIPVIASGWVRTRLEGLGSALG
FT                   RLGLRPPADVREAWHGFTSLSDADSRRAFLATTRAVIDPGGQTVTAHDHLPMDEDIPTL
FT                   VVWGTHDRMIPAWHATTAHQAIPSSRVELFHGAGHFPHLEEPDRFAALLRDFISR"
     atgagcaccc gcacgaccac actgcacggc caccggctgg cctacgtcga ccggggagcc        60
     gggccggcag tcctcttcat ccacgggctc ctcggcacca acgcgaactg gtcccacctc       120
     gtgacgcgcc tcgagaccac ccaccgcgtc gtcgtccccg acctgttcgg ccacggggcc       180
     tccgacaagc cgagagggga ctactcgctc ggtgcgcacg ccgcgacgct gcgcgacctg       240
     ctcgaccggc tcgacatcga ccgggtcacc ctggtcgggc actccctcgg aggcggcatc       300
     gccctccagc tctgctacct cttcccggag cgcgtcgacc gcctcgtcct cgtctccagc       360
     ggcggactgg gccgctccgt cagcccgatc ctccgtgctg ccacgctccc gggcgccgag       420
     gtcgtcatcc ccgtcatcgc ctccggctgg gtgcgcaccc ggctcgaagg gctcgggtcg       480
     gccctgggcc gcctcggtct gcggccgccg gccgacgtgc gcgaggcctg gcacggcttc       540
     acctccctca gcgacgccga cagccgccgt gccttcctcg ccacgacccg ggccgtcatc       600
     gacccgggcg gccagaccgt cacggcccat gaccacctcc cgatggacga ggacatcccc       660
     accctcgtcg tctggggcac ccacgaccgg atgatcccgg cctggcacgc cacgaccgcc       720
     caccaggcca tccccagcag ccgggtcgag ctcttccacg gtgcggggca cttcccccac       780
     ctcgaggagc ccgaccggtt cgccgcgctg ctgcgggact tcatctcccg ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page